aino kishi




FC2MIDVIPXSDABRBDDTTJULAMBIONEZPREDCESDDASDMILKSSNIAVSAMEYDVENXHZGDPPPDHDKASPRD

2011-10-28
152 min

[IPTD-807]Mayu Nozomi Company Trip Turns Into...

  • nozomi eyebrow censoredIPTDidea pocketxtissueIPTD-807IPTD807iptd00807
    • 2012-01-14
    147 min

    [SOE-705]Secret Woman Investigator: Busty Spy Honami Uehara Gets Tied up and Raped

  • uehara honami censoredbig titsSOEs one number one stylehideto akis1 no 1 styleSOE-705SOE705soe00705
    • 2012-09-10
    113 min

    [AUKG-136]The Student Council Head Is A Pervert - My Classmate and I Do Extracurricular Activities - Saki Hatsumi Chika Arimura

  • chika arimura hatsumi saki censoredschoolgirllesbianAUKGu kAUKG-136AUKG13623aukg00136
    • 2013-02-06
    65 min

    [020613-257]Nami Honda

  • nami honda uncensoredcreampiehandjobcaribbeancom
    • 2013-03-28
    116 min

    [MIGD-501]Double Penetration by Tentacles - A Female Investigator Looks Back - Azusa Nagasawa

  • nagasawa azusa censoredanalbig titsMIGDmoodyzgory matsutamoodyz gatiMIGD-501MIGD501migd00501
    • 2013-08-29
    178 min

    [IPZ-186]Please Fuck My Wife Minori Hatsune

  • hatsune minori censoredsingle workIPZidea pockettakuandishIPZ-186IPZ186ipz00186
    • 2014-05-22
    212 min

    [NHDTA-535]A Real Lesbian Cums Again And Again After Using Aphrodisiacs! "Teacher, Even If You Hate Me, I Still Want You..." This Naughty Schoolgirl Holds The Aphrodisiacs In Her Mouth As She Kisses

  • censoredschoolgirllesbianNHDTAnatural highcloud saitoNHDTA-535NHDTA5351nhdta00535
    • 2015-06-13
    148 min

    [SNIS-435]Fresh Face, No. 1 Style - Aki Nana's 28 Year-Old Debut

  • nana leaves censoredbeautiful girlsingle workSNISs1no 1styleflagmanSNIS-435SNIS435snis00435
    • 2015-07-16
    160 min

    [IPZ-597]I Won't Go Home Until You Cum 10 Times! A One Night, Two Day Fuckfest With a Older Man Brimming With Sex Drive! Harumi Tachibana

  • tachibana harumi censoredcosplaysingle workIPZidea pocketxavier thomasdishIPZ-597IPZ597ipz00597
    • 2015-08-05
    120 min

    [SKY-326]Sky Angel Vol.196 : Runa Momose

  • runa momose uncensoredanal
    • 2016-06-10
    212 min

    [VRTM-166]When We Rub An Aphrodisiac Oil Into A Bride Who Came To A Bridal Beauty Salon, She Suddenly Turns Into A Slut! She Doesn't Care That Her Groom Is There, She Convulses As She Gets Fucked Hard! She Gets Creampied By Strangers Before Her W

  • ayumi shinoda is it ozaki censoredcreampiesquirtingVRTMbuoy and earl producebinsento gyaruVRTM-166VRTM166h-910vrtm00166
    • 2016-10-02
    116 min

    [ADN-106]I Just Want To Be Loved By You Saeko Matsushita

  • saeko matsushita censoredsingle workADNattackerssadao sadaokaotona no dramaADN-106ADN106adn00106
    • 2016-12-04
    150 min

    [ATHH-013]"I Want You To Look At My Wet Sexy Pussy While I Perform Masturbation" She's Spreading Her Legs And Showing You What's Inside, Playing With Her Clit And Shoving Her Fingers In Deep! It Feels So Good Pumping My Pussy Like Thi

  • censoredbeautiful girlslutATHHatlantis hupdatingATHH-013ATHH013athh00013
    • 2016-12-18
    139 min

    [KTKB-004]An Ultra New Star A Super Horny Beauty A Quarter Spanish Sally Amuro Hot Blooded Sex With Her Hip Hop Dance Trained Body

  • censoredbeautiful girlKTKBkichikkusu mousouzokuupdatingKTKB-004KTKB004ktkb00004
    • 2016-12-22
    120 min

    [PT-169]Uniform Beautiful Girl Club : Mai Kawasumi

  • mai kawasumi uncensored
    • 2017-02-03
    111 min

    [YAL-052]A Voluptuous And Plump Body Yurika

  • lily flower censoredsingle workYALnonYAL-052YAL052h-127yal00052
    • 2017-05-26
    132 min

    [ABP-600]Sana Imanaga Barebacked And Creampied 17

  • matsunaga sana censoredcreampiebig titsABPprestigeABP-600ABP600
    • 2017-09-27
    24 min

    [276KITAIKE-134]あかり

  • amateur censoredbig titsmarried womankitaikekitaike-134kitaike134276kitaike-134
    • 2017-12-09
    170 min

    [IPX-063]Addicted To Pleasure (Sex) + Ultra Bukkake Sex A Woman Hooked On Sex, Possessed By Sex, And Unable To Live Without Sex Seira Kotomi

  • kotomizu seira censoredbeautiful girlsingle workIPXidea pocketxIPX-063IPX063ipx00063
    • 2018-03-09
    253 min

    [NCAC-021]The Torture & Rape Of A Virtuous Wife

  • censoredNCACnew century bungeishaNCAC-021NCAC021h-1275ncac00021
    • 2018-05-12
    175 min

    [MEYD-370]Reiko Sawamura Has Been Abstaining From Sex For A Year And 2 Months And Now She's Been Teased Repeatedly With Pull Out Sex Until Her Married Woman Animalistic Basic Instinct Has Been Revived So We Can Have Consecutive Rounds Of Orgasmic

  • reiko sawamura honami takasaka masumi takasaka censoredsquirtingmature womanMEYDtameike gorohiroharu osakiMEYD-370MEYD370meyd00370
    • 2018-05-17
    326 min

    [TURA-346]We've Had An Outbreak Of Several Victims At Our Seminar Room At Headquarters... We Slipped Some Date Rape Drugs Into The Test Drinks Of These Lactic Acid Beverage Ladies Who Came For Our Seminar, And Once They Fell Asleep We Fucked Thei

  • censoredcreampiemature womanTURAmilf is hardTURA-346TURA346tura00346
    • 2018-05-19
    120 min

    [MXGS-1045]Wet And Shaved Pussy At A High Class Bathhouse Anna Narumi

  • narumi anna censoredMXGSmaxingMXGS-1045MXGS1045h-068mxgs01045
    • 2018-06-21
    109 min

    [GS-194]I Was Forced To Accompany My Lady Boss To Go Entertain Some Clients. And When The Client Seemed Reluctant To Make A Deal, She Put On The Sexual Harassment Moves And Seduced Him Into Signing A Contract!？ Watching This Made My Dick Get Hard...

  • censoredGSsosoru garconsweet chestnut pasteGS-194GS1941gs00194
    • 2018-06-22
    132 min

    [ABP-743]Natural Airhead Ingredients 120 Shiho Fujie Juices 51 A Voluptuous And Juice-Splattered 4 Fuck Frenzy

  • fumiho fujie censoredbig titssquirtingABPprestigecharlie nakataabsolutely perfectABP-743ABP743118abp00743
    • 2018-07-11
    66 min

    [200GANA-1786]ジョギングナンパ 18

  • amateur censoredcreampiebig titsganagana-1786gana1786200gana-1786
    • 2018-07-26
    128 min

    [HBAD-432]Mourning Dress Widow, Creampied So Much by Relatives

  • takeuchi maya censoredcreampieHBADhibinomamezawa mametarobabeHBAD-432HBAD4321hbad00432
    • 2018-07-27
    141 min

    [MDTM-393]Raw Creampie Hot Spring Trip With Student Hasumi-chan Hasumi Kawaguchi

  • jun kawaguchi censoredcreampiebig titsMDTMmedia stationdocsyspace planningMDTM-393MDTM39361mdtm00393
    • 2018-07-27
    124 min

    [DFE-030]Your Problem Is That You're So Sensitive. Mari Takasugi

  • mari takasugi censoredsquirtingDFEwarp entertainmentthousand holidayfearlessDFE-030DFE0302dfe00030
    • 2018-08-11
    120 min

    [MEYD-410]The Truth Is, I've Been Fucked By My Husband's Boss... Mitsuki Kamiya

  • mitsuki kamiya censoredbig titsmarried womanMEYDtameike gorohiroharu osakiMEYD-410MEYD410meyd00410
    • 2018-08-20
    264 min

    [CEAD-259]Stepmom's Temptation x Creampie Incest

  • kirie kawasaki kaga beauty censoredcreampiebig titsCEADcelebrity friendsCEAD-259CEAD259cead00259
    • 2018-09-02
    240 min

    [HUNTA-491]"Eh？ What Are You Doing Here？" Playful Adopted Sister Burns My Hands! Suddenly Adopted Sister Loves Free Sex And Is A Little Demon..

  • censoredschoolgirlsisterHUNTAhunterborubo nakanoHUNTA-491HUNTA491hunta00491
    • 2018-09-14
    480 min

    [FSB-002]Filthy Video Collection 02

  • censoredFSBprestigeupdatingFSB-002FSB002118fsb00002
    • 2018-10-01
    124 min

    [HDKA-151]Naked Housewife Living In Setagaya An Mashiro (31)

  • anne mashiro censoredcreampiebig titsHDKAplanet plusbirdman teppeirafu shukoHDKA-151HDKA151h-237hdka00151
    • 2018-11-10
    183 min

    [MIDE-594]Fucking Her From Behind While Looking At Her Peachy Ass!! Relentless Fucking That Doesn't Stop Even When She Orgasms. Chinami Ito

  • itou chinami censoredsoloworkMIDEmoodyzgoemonmoodyz divaMIDE-594MIDE594
    • 2018-11-17
    216 min

    [JJBK-016]Mature Women Only. A Mature Woman Visits Your Room. Taking Them Home And Secretly Filming The Sex. Then Selling It As Porn 14. Perverted Women! Big Asses. Wives With Colossal Tits. 165cm/Shizuka/L Cup/39 Years Old. 171cm/Kumiko/H Cup/37 Yea

  • censoredslutJJBKjukujo bank emmanuellemature woman bankJJBK-016JJBK016jjbk00016
    • 2019-01-06
    37 min

    [302GERK-089]あい 23歳

  • amateur censoredcreampiebig titsgerkgerk-089gerk089302gerk-089
    • 2019-01-11
    150 min

    [MDTM-471]Goodbye Light Of Youth ~School Life And Sex With My Classmates~ Ai Hoshina, Yua Nanami, Aya Miyazaki

  • sena ai nanami yua censoredcreampieuniformMDTMmedia stationasagirispace planningMDTM-471MDTM47161mdtm00471
    • 2019-02-07
    119 min

    [FAA-295]She Loves Dirty Old Middle-Aged Men An Amateur Wife Who Loves Giving A Deep And Rich Blowjob And Naughty Kisses

  • censoredmarried womanamateurFAAf aFAA-295FAA2951faa00295
    • 2019-04-05
    176 min

    [DOCP-140]I Couldn't Control The Thrill I Felt From The Total Domain Peeking Out From Underneath Her Miniskirt... 2

  • ayu saito mai tominaga censoredDOCPprestigedoc premiumDOCP-140DOCP140118docp00140
    • 2019-05-04
    120 min

    [SHKD-851]Shame Brought To Light Big Tits Neighbor's Wife Torture & Rape Tragedy Ai Sayama

  • sayama love censoredbig titssingle workSHKDattackersmion nakamurasharkSHKD-851SHKD851shkd00851
    • 2019-07-02
    49 min

    FC2PPV 1117189 [Personal shooting] Tomohame! I took a gonzo like a friend. 22nd Kayoko

  • amateur uncensoredfc2
    • 2019-07-25
    76 min

    [OFRO-004]This Big Sister-In-Law And Her Little Brother-In-Law Are Taking A Bath Together For The First Time In Years "Would You Like To Take A Bath With Your Little Brother-In-Law？" Mayu 20 Years Old Occupation: College Sophomore

  • censoredsisterOFROsod createchain sectappearance crazy amateurOFRO-004OFRO0041ofro00004
    • 2019-09-29
    150 min

    [KTKL-061]This Secretly Big Tits Hair-And-Makeup Artist Came To The Set And I Seduced Her, So Now She's Making Her Adult Video Debut

  • censoredcreampiebig titsKTKLkitixx mousouzokuloliconKTKL-061KTKL061ktkl00061
    • 2019-10-05
    53 min

    [230ORE-565]まい(20)

  • amateur censoredcreampieamateuroreore-565ore565230ore-565
    • 2019-10-22
    137 min

    [SDAB-106]She Spends All Day Fucking Middle-Aged Men Who Are Older Than Her Own Father - Ichika Matsumoto

  • ichika matsumoto censoredschoolgirlsingle workSDABsod creategoemonone s youthSDAB-106SDAB1061sdab00106
    • 2019-11-10
    62 min

    [ksko-007]みゅみゅ

  • amateur censoredschoolgirlamateurkskoksko-007ksko007ksko-007
    • 2020-03-08
    37 min

    [361SEKAO-117]チャンミン from 韓国

  • amateur censoredamateursekaosekao-117sekao117361sekao-117
    • 2020-03-28
    48 min

    [c0930-ki200329]松川 真由 24歳

  • amateur uncensoredc0930
    • 2020-04-14
    19 min

    FC2PPV 1334965 Two Consecutive Vaginal Cum Shots In J ●, An Idol-Class Cute Daddy! The Devil Play W That Scoops The Semen That Was Chopped Up In The Belly With Raw Squirrel From The Window Vibe Ona Compulsion And Rubs It In The Vagina Again

  • amateur uncensoredfc2
    • 2020-05-09
    180 min

    [JUFE-172]We've Never Seen A Babe Like This! A Genuine H-Cup Titty Real-Life College Girl 19 Years Old Her Adult Video Debut This Natural Airhead Is Getting Her Bushy Pussy Hair Wet And Spasming Her Prematurely Ejaculating Pussy Until She Loses H

  • ayase russian pear censoredbig titsJUFEfitchusapyonJUFE-172JUFE172jufe00172
    • 2020-05-10
    159 min

    [SQTE-299]むっちりBODY×チ〇チン＋お酒=ドスケベ動画 大浦真奈美

  • manami oura censoredbeautiful girlslutSQTEs cuteSQTE-299SQTE299sqte00299
    • 2020-05-15
    69 min

    326EVA-117 [Christmas Nampa] Capture A Cosplay Gal Who Gets Drunk With Illumina At A Fashionable Spot ☆ Recorded Video Www

  • amateur censoredamateurcosplayevaeva-117eva117326eva-117
    • 2020-05-24
    240 min

    [CEAD-301]Crouching Slut Cowgirl Sex That Will Suck A Man Dry Of All His Semen 6 Fucks 2

  • namiki touko kana morisawa kanako iioka censoredcreampiebig titsCEADcelebrity friendsCEAD-301CEAD301cead00301
    • 2020-07-04
    120 min

    [SSNI-823]Adultery In A Shared Hotel Room - Virgin Guy Nails His Boss With Big Tits All Night Long On A Business Trip Amu Hanamiya

  • hanamiya amu censoredbig titsSSNIs one number one stylekitorune kawaguchis1 no 1 styleSSNI-823SSNI823ssni00823
    • 2020-07-06
    60 min

    FC2PPV 1427421 [Personal Shooting] Appearance / Umi Her 19-Year-Old / Innocent Beautiful Girl With Big Cock Blowjob, Raw Squirrel, Mass Cum Shot! !!

  • amateur uncensoredfc2
    • 2020-07-16
    37 min

    [SVOKS-132]Chinami

  • censoredcreampiesquirtingSVOKSsadistic village nowhardcore professional sadistic villageSVOKS-132SVOKS132
    • 2020-07-20
    116 min

    [AGMX-055]Dirty Slut Dominating A Man's Body With Obscene Words

  • hasumi claire kimi and ayumi censoredblowjobslutAGMXsex agent daydreamersminimal iwamurasex agentAGMX-055AGMX055agmx00055
    • 2020-08-27
    120 min

    [ARSO-20137]My Wife -Celeb Club- 137

  • mari ayabe momoe hosokawa censoredblowjobARSOaroundARSO-20137ARSO20137h-1378arso20137
    • 2020-08-30
    144 min

    [MMUS-044]Tempted By A Beautiful Little Devil - Ichika Matsumoto

  • ichika matsumoto censoredschoolgirlcosplayMMUSmarrionkijin kasaikcpMMUS-044MMUS044mmus00044



    • JavHD Full is The best Jav censored and uncensored watch online free forever