ass




FC2ROYDSSNIBBANADNKBIPPPDDASDFSDSSMIAAMILKSTARSHDKAMIDVABWGMEMIPXMARAEBODHNDVENX

2019-12-20
150 min

[KATU-063]You'll Be Desperate To Get Your Mouth Around These Gigantic Nipples - 4 Naughty Sluts With Colossal Tits!

  • censoredbig titsslutKATUkatsuo product delusion groupmaglowKATU-063KATU063katu00063
    • 2019-12-20
    99 min

    [YSN-497]My Wife Is Secretly Horny Dear Wife, You Couldn't Stop Fucking And You Never Even Gave His Dick Time To Dry Off His Pre-Cum Kanna Shinozaki

  • kina shinozaki censoredcreampiebig titsYSNnonYSN-497YSN497h-127ysn00497
    • 2019-12-20
    180 min

    [122019_002]Kumiko Kikuchi, Yuko Takahashi, Sachiko Nakahata, Rieko Kobashi, Rino Enoki

  • kumiko kikuchi yuko takahashi uncensoredcreampieblowjobpacopacomama
    • 2019-12-20
    125 min

    [ARM-824]Pile-Drivin' Piston Cowgirl 4

  • rina oumi arisa hanyu censoredslutARMaroma planningmania satoshiaromaARM-824ARM824arm00824
    • 2019-12-20
    119 min

    [GENM-026]Best Hot Ass Mari Takasugi

  • mari takasugi censoredsingle workGENMgenekig 3GENM-026GENM026genm00026
    • 2019-12-20
    72 min

    345SIMM-322 Natsume

  • amateur censoredamateurbeautiful girlsimmsimm-322simm322345simm-322
    • 2019-12-19
    182 min

    [DASD-616]She's Drooling All Over You While Shaking Her Ass A Sleepover Vacation Where She Bares Her True Self "A Beautiful Woman Cunt Tradeoff, In A Young/Old In-N-Out Lusty Swapping Fuck Fest" Rui Hiiragi Yui Nagase

  • scolding yui nagase censoredbig titsbeautiful girlDASDdasrokusaburo mishimaDASD-616DASD616dasd00616
    • 2019-12-19
    61 min

    [121919_222]Yuriko Hosaka

  • yuriko hosaka uncensoredcreampieblowjobpacopacomama
    • 2019-12-19
    27 min

    FC2PPV 1226837 Miu-Chan, A Super Slim 20-Year-Old Jd2, Ascended Twice With An Electric Massage Machine, And At The End From The Almost Appearing Blowjob, A Large Amount Of Shots Were Made To The Ass In The Back!

  • amateur uncensoredfc2
    • 2019-12-19
    121 min

    [DASD-620]My Beloved Wife Gets Me Hard. Under A Spell By Watching Her Sleep With Someone Else. Rin Chibana

  • chibana an censoredsingle workDASDdasrokusaburo mishimaDASD-620DASD620dasd00620
    • 2019-12-18
    64 min

    SIRO-4029 [First shot] [Powerful big butt] A plump BODY girl working in Italian. The ass that the serious girlfriend sticks out is .. AV application on the net → AV experience shooting 1140

  • amateur censoredbig titsamateursirosiro-4029siro4029siro-4029
    • 2019-12-18
    480 min

    [RVG-108]Ass-Lover Shota-kun's Lewd Pranks BEST vol. 3

  • hikaru konno yui hatano censoredRVGglory questRVG-108RVG10813rvg00108
    • 2019-12-17
    75 min

    300MAAN-507 Self-proclaimed Ji-Po Sommelier who eats around Ji-Po from all over the world! !! With a multilingual tongue tech, hold Ji Po to the back of your throat and taste it carefully while vacuum blowjob! !! Extreme face sitting & Norinori co

  • amateur censoredcreampieamateurmaanmaan-507maan507300maan-507
    • 2019-12-17
    53 min

    [121719_221]Yoko Nonaka

  • yoko nonaka uncensoredcreampieuniformpacopacomama
    • 2019-12-15
    67 min

    SIRO-3978 [First shot] [Beautiful salesperson at that store] [Soft milk big ass] A soft milk shop clerk with curly eyes, a neat face for sex after a long time … AV application on the net → AV experience shooting 1137

  • amateur censoredamateurbeautiful girlsirosiro-3978siro3978siro-3978
    • 2019-12-15
    487 min

    [MMBS-007]ASSES THE BEST OF IRIS vol. 4

  • arisa hanyu miki hazuki censoredMMBSmarrionkojiro miyamotomarrion bestMMBS-007MMBS007mmbs00007
    • 2019-12-15
    133 min

    [TIKB-063]Her Programming Must Be Buggy - This Masochistic Slut Loves To Fuck And Cum! Watch Her Scream And Squirt When She Climaxes! Her Meaty Ass Gets Spanked And She Gets Broken In - Ameri Hoshi

  • star ameri censoreddeepthroatsingle workTIKBtikitiki.comerTIKB-063TIKB063tikb00063
    • 2019-12-14
    61 min

    300MAAN-505 Big Ass! Whip legs! The lower half of the body is ferocious … !! If you want to have sex, this kind of woman is definitely good! !! Marshmallow beautiful girl with G cup ass and breasts! !! Best ass job, thigh job! !! You can suffoca

  • amateur censoredsquirtingamateurmaanmaan-505maan505300maan-505
    • 2019-12-14
    150 min

    [BLK-437]# Ass-tagram Furious Ass-Banging Sex With A Bitch Gal Who Likes To Post Pictures Of Her Big Tight Ass On Social Media

  • censoredbig titsblowjobBLKkira kirakira kira black galBLK-437BLK437blk00437
    • 2019-12-14
    173 min

    [GDHH-179]T-Back Housekeeping! These Ladies Will Service Your Room And Your Cock While Showing Off Their Perky Asses In T-Back Panties!

  • censoredcreampieGDHHgolden timekiteretsuhhh groupGDHH-179GDHH179gdhh00179
    • 2019-12-14
    220 min

    [HUNTA-699]"What？! Why Are You Sticking Your Ass Out Like That？ Do You Want Me To Fuck You Or Something？？" 2 - It's Raining Outside, So We're Doing Our Track And Field Practice Indoors

  • censoredcreampieHUNTAhuntermorikihhh groupHUNTA-699HUNTA699hunta00699
    • 2019-12-13
    130 min

    [ZMEN-038]Defenseless Female Boss Taking Off Her Pantyhose Gets Raging Hard Cock From Behind! He Can't Stand It And Cums Right Away! Then Cums Again After They're Back On!! 2

  • manami oura airi aoi censoredZMENz mengoro koenjiZMEN-038ZMEN038h-1371zmen00038
    • 2019-12-13
    121 min

    [VRTM-469]Unable To Endure Celibacy While Hospitalized, This Stepson Gave His Big Ass Stepmom Nurse Some Aphrodisiacs And Then She Rubbed Her White Pantyhose Against Him And A Stain Began To Develop On Her Panties, And Then She Locked Her Legs Around

  • manami oura kana morisawa kanako iioka censoredcreampiesisterVRTMv r producegoro koenjiVRTM-469VRTM469h-910vrtm00469
    • 2019-12-13
    122 min

    FC2PPV 1222846 156/41 Fair-Skinned Slender ♥ ️ D Cup Beautiful Breasts With Almost No Male Experience, 18 Years Old With Nice Ass ♥ ️ While A Naive Beautiful Girl Is Blushing, A Girl ○ Raw Vaginal Cum Shot Sex ♥ ️ Violently Vaginal Cum Shot Massive V

  • amateur uncensoredfc2
    • 2019-12-13
    45 min

    [SENN-002]A Beautiful Nurse Becomes A Slut And Has Creampie Sex In Order To Analyze Her Patient's Sexual Characteristics! Manami Oura

  • manami oura censoredcreampieslutSENNsod createsiberia sakaisex general university hospitalSENN-002SENN0021senn00002
    • 2019-12-13
    119 min

    [VRTM-471]This Kind And Gentle Big Ass Big Stepsister Was Wearing A Tight Skirt And Exerted Her Total Domain Over A Horny Little Stepbrother! When She Was Given Aphrodisiacs, She Started To Rub Her Knee-High Socks Against Him And Dripped Juicy Stains

  • nanako miyamura ririka censoredcreampiesisterVRTMv r producegoro koenjiVRTM-471VRTM471h-910vrtm00471
    • 2019-12-13
    120 min

    [VRTM-468]I Peeked Under The Foot Warmer And I Saw My Stepdaughter's Panty Shot Flashing At Me! I Couldn't Resist, So When I Touched Her Still-Developing Pussy, She Started Getting Dripping Wet And Got Super Horny! Her Mother Is Sitting Right

  • scooping atomi shuri censoredcreampieuniformVRTMv r produceelza nagasakiVRTM-468VRTM468h-910vrtm00468
    • 2019-12-12
    93 min

    [OKP-049]Divine Pantyhose Honoka Suzumi We're Bringing You A Lolita Beautiful Girl In A School Uniform With Beautiful Legs Wrapped In Naughty And Nasty Pantyhose For Fully Clothed Musty Sniffing Pleasure, From Her Soles To Her Toes! Enjoy Face-Si

  • suzumi honoka censoredmature womansingle workOKPdaddy s private photosgodly pantyhoseOKP-049OKP0491okp00049
    • 2019-12-12
    114 min

    [FGAN-005]Creampie Bloomer Pussy Girl Waka Misono

  • misono waka censoredcreampiesingle workFGANfetish eyesFGAN-005FGAN005h-1440fgan00005
    • 2019-12-12
    62 min

    [121219_219]Sakiko Mihara

  • sakiko mihara uncensoredcreampiebig titspacopacomama
    • 2019-12-12
    207 min

    [NHDTB-349]Ekiben Style Creampie J* M****ter 3

  • censoredcreampiesquirtingNHDTBnatural highkansukeNHDTB-349NHDTB3491nhdtb00349
    • 2019-12-12
    93 min

    [OKB-077]A Voluptuous Big Ass A Goddess In Bloomers Lena Aoi From A Lolita Beautiful Girl, To A Chubby Girl, We Dressed These Hot Bitches In Tight Bloomers And Gym Shorts So We Could See Their Asses And Cameltoes Bulging Out So Hard Their Pussy Hairs

  • blue censoredOKBpersonal photography of fathergod bulmaOKB-077OKB0771okb00077
    • 2019-12-12
    157 min

    [DANDY-693]Ass-Shaking Cowgirl Sex While Restraining A Man With A Boner. An Esthetician With A Beautiful Ass Milks Men Dry In A Massage Parlor vol. 2

  • shinoda yu arisa hanyu censoredcreampieslutDANDYdandybacon tanakaDANDY-693DANDY6931dandy00693
    • 2019-12-10
    71 min

    300MAAN-504 Temptation knockout with beautiful ass! !! Good ass, good sensitivity, good Mako’s beautiful president (married woman) is persuaded in Ikebukuro! A lascivious ass with sexual desire. Bring the first-time staff to the toilet and immed

  • amateur censoredcreampiemarried womanmaanmaan-504maan504300maan-504
    • 2019-12-10
    144 min

    [ZBDD-001]She's Got A Tiny Body But Some Big Tits And A Big Ass - Face Sitting/Creampie Sex/Handjob Action/Blowjob Oral Ejaculation/Titty Fuck Action/Cowgirl Sex/Backdoor Fucking/Squirting Orgasmic Ecstasy - A Massive Cum Face Semen Splattering!!

  • yuzuki aisha censoredcreampiebig titsZBDDjitsuroku shuppanrei kudoZBDD-001ZBDD001483zbdd00001
    • 2019-12-10
    480 min

    [MUCH-083]20 Voluptuous Women With Big Asses. Continuous, Ass-Pounding Sex. 8 Hours, 2 Discs

  • censoredMUCHmothermuchi mutchiMUCH-083MUCH083h-796much00083
    • 2019-12-08
    138 min

    [USAG-003][Domestic Amateur Girls Only] We Nampa Seduced An Ulzzang Gal In Shin-Okubo (Big Ass G-Cup Titties)

  • censoredbig titscosplayUSAGrabbit daydreamersUSAG-003USAG003usag00003
    • 2019-12-08
    140 min

    [BAEM-005]Latest: Thick Ass Coaching And Sperm Milking Method Mao Kurata

  • kurata mao censoredcreampiebig titsBAEMbaltanspilma boyemeraldBAEM-005BAEM005baem00005
    • 2019-12-08
    115 min

    [ARM-820]I've Achieved Evolutionary Progress And I'm Getting Excited From Those Tights She's Wearing To Prevent Panty Shot Action, So I'm Getting To Ejaculate Normally

  • ok yui natsuhara censoredARMaroma planninghamu oujiaromaARM-820ARM820arm00820
    • 2019-12-07
    116 min

    [MIAA-201]To Help Me Get Over My Ex-Girlfriend, My Big-Ass Not-My-Sister Let Me Fuck And Creampie Her From Behind Ruka Inaba

  • inaba censoredcreampiebig titsMIAAmoodyzmametaro mamezawaeveryone s porn starMIAA-201MIAA201miaa00201
    • 2019-12-07
    117 min

    [EBOD-726]A Voluptuous Tanned Big Ass Gal Delivery Service For Dirty Old Men With Butt Fetishes You Can Enjoy All The Backdoor And Creampie Sex You Can Handle Masaki Yuishiro

  • masaki yuhaku censoredsingle workEBODe bodyEBOD-726EBOD726ebod00726
    • 2019-12-07
    148 min

    [MIAA-197]Tempted By My Shy-Girl Step-Daughter I Can't Hold Back When She Provokes Me By Giving Me A Full View Of Her Unprotected Panties Mizuki Yayoi

  • mizuki yayoi censoredschoolgirlbeautiful girlMIAAmoodyzgoemoneveryone s porn starMIAA-197MIAA197miaa00197
    • 2019-12-06
    214 min

    [DOCP-189]Sexy First Rate Ass Twerking And Cowgirl Sex To Fill A Friend's Older Sister With Endless Loads Of Cum Until There's None Left vol. 3

  • mitani akari mizuki hayakawa censoredcreampieslutDOCPprestigedoc premiumDOCP-189DOCP189118docp00189
    • 2019-12-06
    64 min

    [120719_217]Miyu Haneda

  • miyu haneda uncensoredcreampiebig titspacopacomama
    • 2019-12-06
    150 min

    [YMDD-175]My Wife Is An Android Beautiful Tits Beautiful Ass High Performance Perfect Body, Cuckold When Charging! Yu Shinoda

  • shinoda yu censoredcreampiehandjobYMDDmomotaro video publishinghimrockwakatoYMDD-175YMDD175ymdd00175
    • 2019-12-05
    26 min

    FC2PPV 1216768 Affair Housewife’s Sexual Confession Documentary [Europe Special Edition] Cum Shot To A Russian Married Woman With A Nice Ass In Her 40s "You Are Jealous Of Seeing This" Dense Sex With A Nice Ass Wife At High Speed [Person

  • amateur uncensoredfc2
    • 2019-12-02
    61 min

    SIRO-3995 [First shot] [Snow skin nice ass] A slender beauty with a hard job, she who was serious about romance … AV application on the net → AV experience shooting 1126

  • amateur censoredamateursirosiro-3995siro3995siro-3995
    • 2019-12-01
    151 min

    [FCDC-111]A Slutty Female Boss Uses Her Rock Hard Nipples And Her Big Ass To Seduce Her Male Staff - Kanna Shinozaki

  • kina shinozaki censoredbig titsslutFCDCweekenderFCDC-111FCDC111fcdc00111
    • 2019-12-01
    138 min

    [KTB-028]Meaty Attendant! - Confessions Of A Former Cabin Attendant With G-Cup Tits - Yurika Aoi

  • yurika censoredbig titssingle workKTBkahanshin tigers mousouzokukahanshin tigersKTB-028KTB028ktb00028
    • 2019-12-01
    140 min

    [TSX-022]Filthy Slut Fetishist 22 Rei Yuino

  • yui no hikari censoredslutsingle workTSXtoramaru fetchtoramaru togashiTSX-022TSX022h-1072tsx00022
    • 2019-12-01
    159 min

    [FLAV-232]HYPER FETISH A Naughty Queen In A High-Cut Outfit Arisa Hanyu

  • arisa hanyu censoredbig titsslutFLAVdigital arkdigital ark digital arkFLAV-232FLAV232flav00232
    • 2019-12-01
    240 min

    [YLWN-097]My Stepmom Sleeps In Lingerie - Younger Guys Visit Their Sexy Older Stepmoms At Night - 240 Minutes

  • censoredlingeriemomYLWNyellow moonpappan tateishiYLWN-097YLWN097ylwn00097
    • 2019-11-30
    164 min

    [AP-720]Housekeepers With Huge Asses - Touching Maids In Tight Pants

  • censoredAPapachegeronimohhh groupAP-720AP720ap00720
    • 2019-11-30
    240 min

    [HUNTA-691]"You Must Be Thrusting Out That Tight Little Ass At Me Because You're Luring Me To Temptation, Right？" Knee-High Socks x Thrust-Out-Ass For A Total Knockout Punch!! I Was Skipping Out On School When My Classmate, A Kind And Gen

  • censoredcreampieschoolgirlHUNTAhuntervolvo nakanohhh groupHUNTA-691HUNTA691hunta00691
    • 2019-11-30
    237 min

    [HUNTA-687]Black Pantyhose And Beautiful Legs & A Godly Ass I'm The Only Man In A Company Filled With Nothing But Women! I Finally Got A New Job, But My New Company Is Fillled With Woman, And I'm The Only Man! I Was So Busy Every Day...

  • censoredcreampieHUNTAhuntercognac kaminohhh groupHUNTA-687HUNTA687hunta00687
    • 2019-11-30
    125 min

    [VGD-203]Ass Royalty - Airi Takasaka, Yukino Matsu

  • airi takasaka matsuyuki censoredbig titsVGDhmjmhajime yanaipornograph tvVGD-203VGD203h-172vgd00203
    • 2019-11-29
    134 min

    [SGA-136]The Greatest Creampie Sex, With The Greatest Lover Of All 50 She Has An Exquisite And Filthy Ass Body With A Small Waist

  • censoredcreampieamateurSGAprestigesetsugetsukaSGA-136SGA136118sga00136
    • 2019-11-28
    63 min

    [112819_213]Satomi Yamauchi

  • amateur uncensoredcreampiebig titspacopacomama
    • 2019-11-28
    41 min

    330PER-185 Mai (23)

  • amateur censoredamateurperper-185per185330per-185
    • 2019-11-26
    61 min

    [112619_212]Yoshino Kikuchi

  • amateur uncensoredcreampieblowjobpacopacomama



    • JavHD Full is The best Jav censored and uncensored watch online free forever