back creampie javcensored jav high vision




FC2DASDDTTAMBIMIDEAUKGHNDGMEMMVSDVENXONEZHODVAWDHMNMEYDSTARSMILKATIDCAWDVEMAKBI

2019-12-14
173 min

[GDHH-179]T-Back Housekeeping! These Ladies Will Service Your Room And Your Cock While Showing Off Their Perky Asses In T-Back Panties!

  • censoredcreampieGDHHgolden timekiteretsuhhh groupGDHH-179GDHH179gdhh00179
    • 2019-12-13
    119 min

    [VRTM-471]This Kind And Gentle Big Ass Big Stepsister Was Wearing A Tight Skirt And Exerted Her Total Domain Over A Horny Little Stepbrother! When She Was Given Aphrodisiacs, She Started To Rub Her Knee-High Socks Against Him And Dripped Juicy Stains

  • nanako miyamura ririka censoredcreampiesisterVRTMv r producegoro koenjiVRTM-471VRTM471h-910vrtm00471
    • 2019-12-10
    144 min

    [ZBDD-001]She's Got A Tiny Body But Some Big Tits And A Big Ass - Face Sitting/Creampie Sex/Handjob Action/Blowjob Oral Ejaculation/Titty Fuck Action/Cowgirl Sex/Backdoor Fucking/Squirting Orgasmic Ecstasy - A Massive Cum Face Semen Splattering!!

  • yuzuki aisha censoredcreampiebig titsZBDDjitsuroku shuppanrei kudoZBDD-001ZBDD001483zbdd00001
    • 2019-12-10
    480 min

    [KTRA-176]Beautiful Stepsister 10 Girls Back To Back Fucking 8 Hours 2 Disc Set

  • censoredcreampiebeautiful girlKTRAk tribeKTRA-176KTRA176h-094ktra00176
    • 2019-11-28
    114 min

    [SPRD-1222]A Stepmom And Her Stepson They Can Never Go Back To The Way Things Were Kaede Tsutsumi

  • tsutsumi maple censoredcreampiemature womanSPRDtakara eizokyuta tukumoaleddinSPRD-1222SPRD122218sprd01222
    • 2019-11-14
    226 min

    [AP-716]An Aphrodisiac-Laced Cock Is Skewering Her Pussy In A Piston-Pumping Back-Breaking Orgasmic Fuck Fest!! This Annoying Big Stepsister Who Treats Us Like Little Kids Is Getting Some Aphrodisiacs Into Her Drink!! And Then She's Gonna Get Her

  • censoredcreampiesisterAPapachepentagonhhh groupAP-716AP716ap00716
    • 2019-11-08
    147 min

    [SCOP-653]When His Stepdaughter Came Back Home For The First Time In A Long While, Her Stepfather Started Feeling Horny, So He Mixed Some Aphrodisiacs Into Her Cup And When She Started Feeling Hot And Feverish, He Took Good Care Of Her, And Made Her

  • censoredcreampiesquirtingSCOPscooplemon matsubaramousouzokuSCOP-653SCOP653h-565scop00653
    • 2019-10-24
    113 min

    [SPRD-1205]A Stepmother And Her Stepson They Can Never Go Back After What Happened Yukari Sakota

  • yukari sakoda censoredcreampiemature womanSPRDtakara eizokyuta tukumoaleddinSPRD-1205SPRD120518sprd01205
    • 2019-10-11
    178 min

    [KBI-019]A KANBi Exclusive She's Back In Action!! A Married Woman From Kobe Honoka Yonekura 35 Years Old Spasmic Orgasmic Creampie Ecstasy (Raw Fucking Creampies) 4 Fucks!! A Real Breast Milk Geyser She's Twice As Erotic After Giving Birth! A

  • hoika yonekura censoredcreampiebig titsKBIprestigesamantha tabatakanbiKBI-019KBI019118kbi00019
    • 2019-10-01
    121 min

    [TUE-093]Lolita Enticed Back To Back Orgasm Fuck Video

  • censoredcreampiebeautiful girlTUEglay zteitora eizoTUE-093TUE09312tue00093
    • 2019-09-28
    151 min

    [JUFE-102]I Took This Runaway Daughter Back Home And Gave Her Impregnation Breaking In Training From Morning Til Night She's All Mine! A Colossal Tits Raw Sex Slave Sachiko

  • sachiko censoredcreampiebig titsJUFEfitchJUFE-102JUFE102jufe00102
    • 2019-09-26
    156 min

    [MIST-276]Legal Public Indecency! A Molester Assault While She Hangs On The Hand Strap A Standing Back Door Raw Penis Insertion With A Delivery Health Call Girl! Creampie Raw Footage! 7

  • murata azu kobayakawa reiko censoredcreampieMISTmr michirusaitaMIST-276MIST2761mist00276
    • 2019-09-21
    133 min

    [DASD-577]I Went Back Home To The Country For Three Days During Summer Vacation, And I Spent The Entire Time Having Basic Instinct Baring Sex With My "Cousin" A Creampie Video Record Mitsuki Nagisa

  • scooping censoredcreampiebeautiful girlDASDdasjo asagiriDASD-577DASD577dasd00577
    • 2019-09-20
    480 min

    [MBM-072]All I Do Is Go From My House To Work And Back Again, But I'm On The ID Bulletin Board, Fucking Some Prime Pieces Of Pussy, So, Any Questions？？ 18 Fantastic Amateur Babes 8 Hours

  • censoredcreampiebig titsMBMprestigetakayama coin chestmbmMBM-072MBM072118mbm00072
    • 2019-09-13
    142 min

    [HGOT-008]Summer Vacation 3 Years After Graduation - Adult Men Sneak Back Into Their Alma Mater To Get Their Fuck On

  • censoredcreampieHGOTn aHGOT-008HGOT008h-1414hgot00008
    • 2019-09-13
    121 min

    [VRTM-453]This Little Brother-In-Law Is Lusting For His Kind And Gentle Big Ass Big Sister-In-Law Who Wears A Tight Skirt! When He Gave Her Aphrodisiacs To Drink She Started Rubbing Her Knee-High Socks Up Against Him And Staining Her Panties, And The

  • otsuki sound yuki sakuragi censoredcreampiesisterVRTMv r producerokutanzo no seishiVRTM-453VRTM453h-910vrtm00453
    • 2019-09-12
    118 min

    [JURA-019]First Time Shots Married Woman Back For More. Hiromi Shinoyama

  • hiromi shinoyama censoredcreampiemature womanJURAcenter villageminatoyajurakuJURA-019JURA019h-086jura00019
    • 2019-09-12
    106 min

    [SPRD-1187]Stepmother And Son Can't Take It Back Towako Kusunoki

  • tokiko kashiwagi censoredcreampiemature womanSPRDtakara eizokyuta tukumoaleddinSPRD-1187SPRD118718sprd01187
    • 2019-08-26
    41 min

    [MIHA-019]Legally Open, Public Obscenity! Molester Holds The Hanging Leather And Comes Inside From The Back of a Callgirl! Raw Creampie Footage! Mio Kimishima

  • kimishima mio censoredcreampiebig titsMIHAmr michirumr michiru s sex club videosMIHA-019MIHA0191miha00019
    • 2019-08-25
    118 min

    [GENM-017]A Girl Who Keeps Cumming Back For More Creampie Sex Amy Fukada

  • emi fukada censoredcreampieslutGENMgenekifukadaGENM-017GENM017genm00017
    • 2019-08-16
    133 min

    [GIRO-058]When A Girl In Gym Shorts Comes Back To Get Something During Gym Class, Her Classmate, Who Is A Cherry Boy With A Penchant For Taking Measurements, Measures Her Body, Molests Her And Gives Her A Big Creampie LOL

  • censoredcreampieschoolgirlGIROprestigeogleGIRO-058GIRO058118giro00058
    • 2019-08-16
    144 min

    [BLK-416]A Convenient Gal Lover This Bitch Keeps Coming Back For More Sweaty And Squishy Sex Because She Loves Fucking Dirty Old Men, And Now She's Committing Creampie Adultery Until The Break Of Dawn Kaho Imai

  • natsuho imai censoredcreampiebig titsBLKkira kirakira kira black galBLK-416BLK416blk00416
    • 2019-08-11
    128 min

    [DVAJ-406]Doggystyle Sex Makes Her Legs Twitch Like A Newborn Deer Nanami Kawakami

  • kawakami nanami censoredcreampiesingle workDVAJalice japanjo asagiriDVAJ-406DVAJ406dvaj00406
    • 2019-08-08
    153 min

    [DANDY-677]"The Big-Assed Married Woman Couldn't Refuse Doggy Style Cunnilingus And Creampie" vol. 1

  • censoredcreampieDANDYdandybacon tanakaDANDY-677DANDY6771dandy00677
    • 2019-07-07
    120 min

    [MEYD-509]Going Back To Her Hometown Without Her Husband. She Passionately Kisses Her Childhood Friend After Bumping Into Him And Keeps Fucking Him Even After She Orgasms. 3-Days And 2-Nights Adultery. Airi Kijima

  • airi kijima censoredcreampiesingle workMEYDtameike gorohiromichi hoseMEYD-509MEYD509meyd00509
    • 2019-07-05
    140 min

    [UMD-694]Doggie Style Only - Ass Fucking - Best Selection TOP 20 Ver. 2019

  • yano tsubasa mitani akari censoredcreampieUMDleotabu osakiUMD-694UMD694125umd00694
    • 2019-06-22
    120 min

    [HND-682]Slutty Girl Milks Out Creampies Back To Back With Amazing Nipple Play Shoko Akiyama

  • shoko akiyama censoredcreampieslutHNDhon nakamiyoshi rusherHND-682HND682hnd00682
    • 2019-06-21
    128 min

    [WZEN-024]Back For Seconds Nao

  • censoredcreampieWZENwaap entertainmentWZEN-024WZEN0242wzen00024
    • 2019-06-15
    240 min

    [AP-665]A Plain And Timid Girl Who Works At A Factory Can't Fight Back Even When She Gets Sexually Harassed. The Men Do What They Like With Her Day After Day, And No Matter How Many Times She Gets Creampied, She Just Wipes Herself With A Tissue W

  • censoredcreampieuniformAPapachenachiguronhhh groupAP-665AP665ap00665
    • 2019-06-15
    282 min

    [AP-664]Whole Family Pass Around Back To Back Creampie Molestation 21 In All! Ver.

  • censoredcreampiesisterAPapachenachiguronhhh groupAP-664AP664ap00664
    • 2019-06-14
    118 min

    [SABA-530]I Had A Former Prep School Student Of Mine Wear A Real Uniform From Back Then And Fucked Her. H Cup College Girl Living At Home In Saitama Loves Old Men And Has The Cutest Pupils H Cup 19 Years Old

  • censoredcreampiebig titsSABAskyu shirotoSABA-530SABA530h-244saba00530
    • 2019-05-31
    111 min

    [GIGL-550]It's been five years since I graduated from a lower-level school back home and moved to Tokyo, and yet even though I'm a permanent part-time jobber, women want a piece of me!？ Women my age don't want me in the slightest, but tha

  • censoredcreampiebig titsGIGLgigolo gigologigoloGIGL-550GIGL550h-860gigl00550
    • 2019-05-16
    119 min

    [PPPD-758]The Girl I Molested Was A Childhood Friend I Was In Love With Who Also Loved Me Back. The Strange Love Between Me And The Girl Who Pretended Not To Notice And Let Me Touch Her Big Tits. JULIA

  • julia censoredcreampiebig titsPPPDoppaiPPPD-758PPPD758pppd00758
    • 2019-03-23
    134 min

    [CESD-741]Convulsive, Back-Arching, Animalistic Sex Covered In Oil. Tsubasa Hachino

  • yano tsubasa censoredcreampiemature womanCESDceleb no tomoCESD-741CESD741cesd00741
    • 2019-02-08
    239 min

    [BAZX-170]She's Starring In This Adult Video Behind Her Husband's Back Sex With A Married Woman 4 Hours

  • censoredcreampieblowjobBAZXmedia stationtodobazookaBAZX-170BAZX17061bazx00170
    • 2018-12-29
    184 min

    [AP-618]This Part-Time Worker At A Family Restaurant Is Getting Her Nipples Tweaked In Siren Orgasmic Back-Arching Creampie Molester Molestation

  • censoredcreampiebig titsAPapachekuniokahhh groupAP-618AP618ap00618
    • 2018-11-23
    111 min

    [GIGL-525]It's been five years since I graduated from a lower-level school back home and moved to Tokyo, and yet even though I'm a permanent part-time jobber, women want a piece of me!？ Women my age don't want me in the slightest, but tha

  • censoredcreampiebig titsGIGLgigolo gigologigoloGIGL-525GIGL525h-860gigl00525
    • 2018-10-12
    150 min

    [MDB-944]OK To Cum! OK From The Back! Hottie Creampie Bus Attendant's Vaginal Garage Is Ready!

  • hanasaki ian nimo censoredcreampiebig titsMDBmedia stationhiroshi nikumarubazookaMDB-944MDB94461mdb00944
    • 2018-07-21
    120 min

    [JUY-564]He Couldn't Hold Back When His Wife's Friend Played With His Nipples... Creampie-Explosion Fuck At The Massage Parlor Ayana Mimasaka

  • mimasaka ayame censoredcreampiemature womanJUYmadonnabiba gonzoJUY-564JUY564juy00564
    • 2018-07-08
    202 min

    [BCDP-100]Spectacular Girlfriend Aya Sazanami Sensitive, Slender Beauty Squirting Wild Orgasmic Creampie Sex

  • censoredcreampiesquirtingBCDPback dropupdatingback drop back dropBCDP-100BCDP100bcdp00100
    • 2018-06-03
    183 min

    [AP-551]The "S" Maid Gets Attacked By The Creampie Molester In Back Breaking Hard Piston Pounding Sex

  • censoredcreampieAPapache demandkuniokaAP-551AP551ap00551
    • 2018-06-02
    120 min

    [PRED-080]The Man Who Turned Me Back Into A Bitch Saryu Usui

  • sakisui censoredcreampiesingle workPREDpremiumtorendei yamaguchiPRED-080PRED080pred00080
    • 2018-03-25
    117 min

    [EIKI-067][We're Back Again] A Stroll With A Dirty Old Man 18 "I Always Immediately Want Cock... Am I Sick？" This Neat And Clean Horny Wife And A Dirty Old Man Are Taking A Walk Together On A Downtown Date Yu Kawakami

  • yu kawakami morino morino censoredcreampiesingle workEIKIbig morkalkabin kizakuraeikiEIKI-067EIKI06757eiki00067
    • 2018-03-16
    184 min

    [DOCP-031]Plain, Sweet & Serious Childhood Friend Moves Away, Comes Back As Ultra Talented Pervert Sex Machine!

  • ayumi hebei aoi sato censoredcreampieslutDOCPprestigedoc premiumDOCP-031DOCP031118docp00031
    • 2018-03-03
    120 min

    [HND-485]Pregnancy Guaranteed! Back Breaking Raw Cock Pregnancy Fetish Creampie Sex! Akari Mitani

  • mitani akari censoredcreampiesingle workHNDhon nakasapporo taroHND-485HND485hnd00485
    • 2018-02-09
    125 min

    [XRW-429]An Orgasmic Back Breaking Spasmic Unstoppable Forbidden G-Spot Blooming Erotic Oil Massage ACT.002 Arisa Hanyu

  • arisa hanyu censoredcreampiebig titsXRWk m producetodoXRW-429XRW429172xrw00429
    • 2017-11-03
    117 min

    [HND-447]Pregnancy Guaranteed! Back Breaking Raw Cock Pregnancy Fetish Creampie Sex! Seira Hoshisaki

  • hoshizaki seira censoredcreampiebeautiful girlHNDhonnakakirinHND-447HND447hnd00447
    • 2017-09-21
    122 min

    [KMHR-011]Mikoto Hino She's Gone To Tokyo Behind Her Husband's Back For Creampie Sex 2 Hours Nonstop 21 Cum Shots

  • hino mikoto censoredcreampiesingle workKMHRsod createnagashimeKMHR-011KMHR0111kmhr00011
    • 2017-07-29
    148 min

    [BLK-325]Stop, Time! ~Getting Back At The Bratty Girl Who Bullied Me With A Creampie!~ Rika Mari

  • mari rika censoredcreampieschoolgirlBLKkira kirakira kira black galBLK-325BLK325blk00325
    • 2017-05-26
    200 min

    [SCPX-201]I'm Sorry, I Can't Pay You Back That Money I Owe You, So Take It Back Out Of My Wife! So Saying, My Best Friend Sent Me His Own Wife To Serve As My Pussy Powered Maid!

  • censoredcreampiebig titsSCPXscoopshionmousouzokuSCPX-201SCPX201h-565scpx00201
    • 2017-05-12
    151 min

    [MDB-782]Back From The Dead!! These 4 Big Tits Sisters Save Their Convenience Store From Bankruptcy

  • erica kitagawa mizutani heart sound rio fujisaki censoredcreampiebig titsMDBmedia stationkuwattibazookaMDB-782MDB78261mdb00782
    • 2017-05-11
    118 min

    [HND-403]Pregnancy Guaranteed! Back Arching Raw Pregnancy Fetish Creampie Sex! Rika Mari

  • mari rika censoredcreampiebeautiful girlHNDhon nakaHND-403HND403hnd00403
    • 2017-05-01
    86 min

    [VOSS-036]Everyone Advanced Except For Me, And I Was Stuck Back A Grade, And When The Lady Next Door Kept Teasing Me, She Was So Pretty And Hot That I Ended Up Committing Rape! I Thought That My Life Was Over Now, But She Declared, "You're No

  • yuki seijyo censoredcreampiemature womanVOSSvenuspeterthe matures projectVOSS-036VOSS036voss00036
    • 2017-03-17
    231 min

    [HUNTA-280]My Aunties Live In City And They're Back Home For The First Time In A While, And Man They Are Sexy And Hot! 3 I Got Instantly Hard Looking At Their Cleavage And Panty Shot Action, And I Thought They Would Treat Me Like A Child, But Ins

  • censoredcreampieHUNTAhunterkawajirihhh groupHUNTA-280HUNTA280hunta00280
    • 2017-03-02
    193 min

    [DANDY-539]"Once You Get A Taste You Can Never Go Back! Rika Mari Is Doing A Reverse Pick Up With Mega Cock Black Men Vacationing In Japan For Creampie Raw Footage Sex"

  • mari rika censoredcreampiesingle workDANDYdandymaeka mataoDANDY-539DANDY5391dandy00539
    • 2016-12-01
    130 min

    [JJPP-079]A DVD Featuring Peeping Videos Of Handsome Guys Who Bring Back Mature Woman Babes Home For Sex 69 And They Forced Them Into Creampie Sex Too

  • censoredcreampieblowjobJJPPjukujo japandont knowJJPP-079JJPP079jjpp00079
    • 2016-06-12
    145 min

    [APKH-012]A JK With A Big Ass And Beautiful Tits Haruka Furious Back Breaking Cowgirl Sex, Scream With Pleasure And Sweaty, Cum-Filled Sex... "I'm A Meat Eater..." Haruka Aso

  • haruka aso censoredcreampiebig titsAPKHaurora project annexupdatingAPKH-012APKH012apkh00012
    • 2016-06-10
    126 min

    [HAR-035]This Annoying Bitch Who Got Power Harassed Out Of Her Job Came Back To Claim Her Rights, So We Slipped Her Some Strong Aphrodisiacs And Banged Her Pussy So Hard She Flipped Like Fried Shrimp

  • ayaka kuroki kasukabe censoredcreampieHARprestigedont knowhardestHAR-035HAR035118har00035
    • 2016-03-19
    147 min

    [HND-274]I Want to Go Back to Singing... Her First Ever Real Creampie Sex!!! Sora Shiina

  • shiina sky censoredcreampiebeautiful girlHNDhon nakatequilia tinoHND-274HND274hnd00274
    • 2016-01-23
    119 min

    [HND-257]The Pleasure of Being Creampied When You Can't Fight Back!! Kanna Misaki

  • kanna misaki censoredcreampiebeautiful girlHNDhon nakanaveHND-257HND257hnd00257



    • JavHD Full is The best Jav censored and uncensored watch online free forever