javcensored censored def jav cosplay




FC2AUKGBBANVENXSANATIDVENUSSNIJUFEFSDSSDASDDASDMIDEGVHMARAHNDWAAADTTMIDVMEYDONEZ

2018-04-21
100 min

[OAE-143]After School Chinami Ito

  • chinami ito censoredbig titscosplayOAEaircontrolOAE-143OAE143
    • 2018-04-21
    151 min

    [KAWD-888]A Real Idol Moko Sakura A Sure Thing Real-Life Temptation Situation 6 Otaku Cosplay Transformations!

  • sakura moko censoredcosplaybeautiful girlKAWDkawaiitake dKAWD-888KAWD888kawd00888
    • 2018-04-21
    103 min

    [OAE-145]Naked Ayaka Ayaka Fukai

  • ayaka fukai censoredbig titscosplayOAEaircontrolOAE-145OAE145oae00145
    • 2018-04-18
    135 min

    [GVG-668]She's Glad That She's My Pervert Anal Pet Yuzu Kitagawa

  • yuzu kitagawa censoredGVGglory questchintaGVG-668GVG66813gvg00668
    • 2018-04-16
    240 min

    [MXSPS-573]Ruri Kamiya Complete Greatest Hits Collection 4 Hours

  • yuri kamiya censoredcosplayMXSPSmaxingMXSPS-573MXSPS573h-068mxsps00573
    • 2018-04-14
    172 min

    [IPX-126]FIRST IDEA POCKET She's Shocking Us With Her Sudden Participation! A Sex-Crazed G Cup Titty Beautiful Tits Beautiful Ass IP Has Descended Upon Us!! Sana Matsunaga

  • sana matsunaga censoredIPXidea pocketusapyontissueIPX-126IPX126ipx00126
    • 2018-04-13
    129 min

    [REAL-672]If You Can't Ejaculate Within 10 Minutes While Receiving Rika Mari's Exquisite Blowjob Technique, She'll Make Amends By Letting You Fuck Her In The Pussy To Your Heart's Content!

  • mari rika censoredblowjobcosplayREALreal workstiger gavelreal real worksREAL-672REAL672172real00672
    • 2018-04-13
    154 min

    [MKMP-221]The Ultimate Hospitality A Full Course Of Whore Towa Satsuki

  • satsuki towa censoredbig titssquirtingMKMPkm producetequilatinomillionMKMP-221MKMP22184mkmp00221
    • 2018-04-13
    120 min

    [BOKD-112]Bulging Bursting Cock Cosplay 3 Fucks Anna Tsukishima

  • tsukishima anna censoredcreampiecosplayBOKDour man s daughtersuginokiBOKD-112BOKD112h-995bokd00112
    • 2018-04-12
    241 min

    [HAWA-137]"This Kind Amateur Middle Aged Woman Let Us Fuck Her Without Condoms, And Treated Our C*cks Better Than Her Husband's" Real Creampie Offline Meetings A Loveable Wife With Big Tits Smiles As She Gets 16 Creampies Naomi-san (38 Ye

  • censoredcreampiebig titsHAWAcosmos videonagase hawaiicosmos video soft on demandHAWA-137HAWA1371hawa00137
    • 2018-04-07
    168 min

    [JUFD-896]A Horny Voluptuous Cosplayer In An Impregnation Orgy Film Session! Umi Mitoma

  • umi mitsumata censoredcreampiecosplayJUFDfitchJUFD-896JUFD896jufd00896
    • 2018-04-07
    147 min

    [MIFD-037]An Otaku Girl Who Attends Anime School And Has Unbelievable Sexual Hunger Is Making Her AV Debut Sora Kamikawa

  • kamikawa starry sky censoredsquirtingcosplayMIFDmoody stake dmoodyz freshMIFD-037MIFD037mifd00037
    • 2018-04-07
    216 min

    [MIDE-537]Total Domain The Temptation Of A Totally Horny Elder Sister In Knee-High Socks Chinami Ito

  • chinami ito censoredcosplayslutMIDEmoodyzMIDE-537MIDE537
    • 2018-04-06
    125 min

    [HODV-21288]A Fairy Tail Tails x Anal Plugs A Cute And Weak-Willed Ultra Sadistically Beautiful Kitten Will Slap Men Into Shape And Break Them Down Like Lowly Slaves! The Strongest Reverse Breaking In Training Sex! Miyuki Sakura

  • sakura miyuki censoredHODVh m pa teamfairy taleHODV-21288HODV2128841hodv021288
    • 2018-04-06
    111 min

    [YMDD-119]If This Music Student Who Aspires To Be A Pianist Makes Her AV Debut, Will She Excessively Awaken Her Lust!？ Liz Suzuki Presents Kurumi Tamaki

  • tamaki walnut censoredcreampiebig titsYMDDmomotaro video publishinglizyoung peachYMDD-119YMDD119ymdd00119
    • 2018-03-31
    157 min

    [DASD-419]Maso Bitches Only An Offline Fuck Filming Session A Famous Sadist Tanned Gal Cosplayer AIKA

  • aika censoredbig titscosplayDASDdassclown fieldDASD-419DASD419dasd00419
    • 2018-03-27
    122 min

    [AKB-059]Big Black Dicks Vs A Horny Cosplayer Rika Mari

  • mari rika censoredcreampiecosplayAKBtmasouthexpotionAKB-059AKB05955akb00059
    • 2018-03-25
    182 min

    [DAPD-004]Serious Hypnotism x Amateur Cosplayer 4 Outdoor Pissing Geyser Exhibitionist Plays & Drooling Spittle Filled Creampie Cumming Loser Maso Breaking In Training [Starting From Scratch With A Suggestion / Outdoor Breaking In / Brainwashing T

  • censoredamateurcosplayDAPDtmadoujin akiba publishingDAPD-004DAPD00455dapd00004
    • 2018-03-23
    117 min

    [PXH-005]Cosplay Cannonball RUN.05 E Cup Sized Beautiful Tits x Beautifully Divine Legs x A Pretty Ass x A Woman Who Likes To Stroke Men Ren Yoshikawa

  • yoshikawa lotu censoredcosplayPXHprestigecompany matsuoprestige hmjmPXH-005PXH005118pxh00005
    • 2018-03-18
    109 min

    [OAE-142]Nude God Aika Yamagishi

  • aika yamagishi censoredcosplayOAEaircontroltakashi kakutaniOAE-142OAE142oae00142
    • 2018-03-18
    105 min

    [OAE-141]ALL NUDE Ayane Haruka

  • ayane haruka censoredcosplaymature womanOAEaircontroltakashi kakutaniOAE-141OAE141oae00141
    • 2018-03-16
    220 min

    [ATOM-321]Consecutive Panty Shot And Titty Shot Action! Amateurs Only! She's Spinning Round And Round In A Quick Change Obstacle Race

  • censoredamateurcosplayATOMatomincredible potashhhh groupATOM-321ATOM321atom00321
    • 2018-03-10
    119 min

    [MIAE-193]This Maso Little Kitten Turned Into A Horny Young Girl Mari When We Punished This Innocent Little Pervert For Begging For Too Much Cock, She Started Twitching And Spasming In Ecstasy!! Mari Takasugi

  • mari takasugi censoredcosplayMIAEmoody smoodyz acidMIAE-193MIAE193miae00193
    • 2018-03-10
    167 min

    [WANZ-730]Nipple Cosplay This Beautiful Girl Has Nipples So Sensual She Can't Even Wear Clothes, But She's Going To This Cosplay Offline Meetup Yu Asakura

  • yu asakura censoredcreampiecosplayWANZones factorywanzWANZ-730WANZ730wanz00730
    • 2018-03-09
    119 min

    [MDTM-340]All New After School With A Beautiful Girl Rejuvenating Reflexology + Vol.010 Mai Nanase

  • nanase mai censoredcreampieblowjobMDTMmedia stationtodospace planningMDTM-340MDTM34061mdtm00340
    • 2018-03-03
    119 min

    [CJOD-133]She'll Tease Your Cock With Her Tongue And Then Suck It Down Hard! A Blowjob Loving Beauty Shows Off Her Spine Tingling Blowjob Technique Ai Hoshina

  • sena ai censoredblowjobcosplayCJODslut havencomet akaiCJOD-133CJOD133cjod00133
    • 2018-03-03
    121 min

    [MVSD-345]A Beautiful Girl Cosplayer Surrogate Creampie NTR Minori Kawana

  • real village hena censoredcreampiecosplayMVSDm s video groupkitorune kawaguchiMVSD-345MVSD345mvsd00345
    • 2018-02-25
    152 min

    [DAPD-003]Real Hypnotism x An Amateur Cosplayer 3 A Nice And Meaty Cosplayer This Maso Bitch IS Undegroing Personality Rectifying Brainwashing And Now Will Piss Outdoors With The Snap Of A Finger And Squirt A Geyser Of Piss And Spit And Loves To Get

  • censoredcreampieamateurDAPDtmadoujin akiba publishingDAPD-003DAPD00355dapd00003
    • 2018-02-23
    127 min

    [CPDE-019]Strongest Attribute 19 Hikaru Konno

  • hikaru konno censoredcreampiecosplayCPDEprestigestrongest attributeCPDE-019CPDE019118cpde00019
    • 2018-02-18
    119 min

    [OAE-140]Nude God Shoko Takahashi

  • shoko takahashi censoredbig titscosplayOAEaircontrolOAE-140OAE140oae00140
    • 2018-02-10
    117 min

    [WANZ-723]A Real Life College Girl Famous Cosplayer!! An Ultra Sensual And Wet AV Debut Minto Iori She's Got A Horny Pussy That Gets Dripping Wet When You Stare At It "Please Don't Film Me So Closely... You'll See My Pussy Stains...&q

  • censoredcreampiecosplayWANZones factorywanzWANZ-723WANZ723wanz00723
    • 2018-02-01
    154 min

    [SS-134]Amateur Sailor Cosplay Creampie 134 Ann Wakamoto This Light Skin Black Hair Lolicon F Cup Big Tits Girl Has An Unusually Bushy Pussy!

  • ann wakamoto censoredcreampiebig titsSSplumamateur only plumSS-134SS134h-113ss00134
    • 2018-01-31
    173 min

    [SAIT-013]A Beautiful Girl Mechanical Doll *B x Anal & Pussy 2 Hole Creampie Fucks x 10 Consecutive Massive Bukkake Fucks Honoka Mihara

  • censoredcreampiecosplaySAITtmacosplay bondage clubSAIT-013SAIT01355sait00013
    • 2018-01-26
    118 min

    [PXH-003]Cosplay Cannonball RUN.03 D Cup Beautiful Tits x A Pretty Ass x Shame Driven Lust x A Hakata Beauty Mai Kaede

  • appearance censoredbig titscosplayPXHprestigecompany matsuoprestige hmjmPXH-003PXH003118pxh00003
    • 2018-01-20
    94 min

    [OAE-138]Hot Girl Gemma

  • gemma censoredbig titscosplayOAEaircontrolOAE-138OAE138oae00138
    • 2018-01-12
    141 min

    [ONGP-108]Bullied Maid - Seiran Igarashi

  • seirang igarashi censoredcreampiecosplayONGPmedia stationsuginokionafes 2018ONGP-108ONGP10861ongp00108
    • 2017-12-29
    51 min

    [ETQR-020]Pregnant OK Maid Child-making SEX Mari Wakatsuki

  • censoredcreampiecosplayETQRerotic timeETQR-020ETQR020h-1186etqr00020
    • 2017-12-29
    44 min

    [ETQR-021]Pregant OK Maid Child-making SEX Urara Yotsuba

  • censoredcreampiecosplayETQRerotic timeETQR-021ETQR021h-1186etqr00021
    • 2017-12-22
    224 min

    [T28-520]Creampie Sex With Beautiful Girl Wearing Underwear Popular With Cosplayers

  • azuki tomomi hoshisaki censoredcreampiecosplayT28tmaT28-520T2852055t2800520
    • 2017-12-15
    142 min

    [SON-539]Blonde x Huge Tits x Cosplay x Explosive Hips x Horny Slut

  • censoredcreampiebig titsSONupsonbobo ikebukuroSON-539SON539h-766son00539
    • 2017-11-10
    139 min

    [MKMP-205]Kizuna Sakura Perfect Cosplay SUPER

  • sakura kizuna censoredcosplaydramaMKMPkm producegory matsudamillionMKMP-205MKMP20584mkmp00205
    • 2017-10-21
    101 min

    [OAE-127]ALL NUDE Riku Minato

  • eternal censoredbig titscosplayOAEaircontrolzach araiOAE-127OAE127oae00127
    • 2017-10-14
    120 min

    [JUY-273]A Horny Father-In-Law Is Fucking With His Daughter-In-Law Father, Please Forgive Me... Izumi Nanase

  • censoredmarried womancosplayJUYmadonnaviva gonzoJUY-273JUY273juy00273
    • 2017-09-29
    135 min

    [ABP-643]Sports Cosplay Sweaty Sex 4 Fucks! Sports Jock Sana Imanaga Act.10 10

  • sana imanaga censoredbig titscosplayABPprestigeshoulder openabsolutely perfectABP-643ABP643118abp00643
    • 2017-09-25
    120 min

    [EIKI-054]A Super Slut Mei Lin I Don't Like To Use Condoms! A Natural Airhead F Cup Big Tits Cosplayer! This Famous Cosplayer Who Loves Dirty Old Men Is Having Babymaking Creampie Hypnotism Sex

  • meiri censoredcreampiebig titsEIKIbig mocaleikiEIKI-054EIKI05457eiki00054
    • 2017-09-23
    144 min

    [MIDE-466]Drown in Tsubomi's ass at Soapland.

  • bud censoredcosplayMIDEmoody sflagmanmoodyz divaMIDE-466MIDE466mide00466
    • 2017-09-22
    480 min

    [ID-038]Sperm Collection Ward - Hospital Full Of Naughty Nurses Out For Your Seed - Kurea Hasumi Tsubasa Hachino Azusa Misaki

  • nagomi niko censoredcosplayIDtmaID-038ID0385525id00038
    • 2017-09-08
    130 min

    [ARM-630]Favored By Camera Freaks An Underground Idol Cosplay Mania Photo Shoot

  • yuna yamakawa yuzu kitagawa censoredcosplaybeautiful girlARMaroma planningtakato kasaiaromaARM-630ARM630arm00630
    • 2017-09-01
    208 min

    [AVOP-375]Strongest attribute ~ another story ~

  • mayu tateishi ayane harukana censoredcosplayAVOPprestigecp countrysideav open 2017AVOP-375AVOP375118avop00375
    • 2017-08-20
    91 min

    [OAE-125]ALL NUDE Hanon Hinana

  • hinana is no censoredbig titscosplayOAEaircontrolOAE-125OAE125oae00125
    • 2017-07-22
    116 min

    [MIAE-097]Stared At And Raped The Spectacular Edition

  • sakaegawa noa ai mukai censoredcosplaybeautiful girlMIAEmoody syasuda salmonmoodyz acidMIAE-097MIAE097miae00097
    • 2017-07-08
    121 min

    [PARM-121]Horny Cheerleader 2

  • miyu saito akemi miu censoredcosplaybeautiful girlPARMaroma planningdelusional chirarismPARM-121PARM121parm00121
    • 2017-07-08
    145 min

    [MRXD-040]An Innocent And Sweet Barely Legal The Discovery! An A Cup Shy Girl I Like To Be Licked

  • censoredcreampieamateurMRXDmarxmarx marx brothersMRXD-040MRXD040mrxd00040
    • 2017-07-06
    138 min

    [SDMU-630]SOD Female Employees A Young Marketing Department 2nd Year Employee Momo Kato (Age 21) She'll Do Her Best To Grant Everyone's Request "Show Us What We Want To See!" Her First Ever 7 Episode 4 Fuck Experience Soapland Sex 3 C

  • kato momoka censoredcosplaySDMUsod createichiro kanedasod female employeeSDMU-630SDMU6301sdmu00630
    • 2017-07-01
    133 min

    [SS-131]Amateur Sailor Cosplay Creampie (Revised) 131 Nami Sekine This Neat And Clean Pure JK With Silky Smooth Skin And A Pretty And Tight Ass Is Looking Good! She Looks Proper And Cute But She Loves Masturbation Oh My Pussy, I Love You

  • nami sekine censoredcreampieschoolgirlSSplumamateur only plumSS-131SS131h-113ss00131
    • 2017-06-11
    145 min

    [DVAJ-242][The Strongest Combo] Ultra Beatiful Tits Idol x Ultra Cute Cosplay x 5 Episodes x Fully Clothed Sex Plays Moe Cosplay Yui Takamiya

  • yui takamiya censoredbig titscosplayDVAJalice japankyouseiDVAJ-242DVAJ242dvaj00242
    • 2017-04-28
    121 min

    [SUPA-158]'Young Wife Pervert Club (Edition)'. Member No. 009. Ami, 23.

  • censoredcreampiebig titsSUPAclass s amateurtaro kSUPA-158SUPA158h-244supa00158
    • 2017-04-27
    479 min

    [OFJE-112]Arina Hashimoto: 1st Anniversary. Her Best-Of First Timers.

  • there is hashimoto censoredsquirtingcosplayOFJEs one number one styles1 no 1 styleOFJE-112OFJE112ofje00112
    • 2017-04-22
    150 min

    [WANZ-614]A Famous Cosplayer A Once In A Month Danger Day Offline Meetup Yu

  • censoredcreampiebig titsWANZones factorywanzWANZ-614WANZ614wanz00614
    • 2017-04-07
    95 min

    [YMDD-101]Offline Fucking! Vol.2 We Found Fuckable Big Tits Cosplayers At A Cosplay Convention And Tricked Them Into Baby Making Sex! Yua Imai

  • yui imai censoredbig titscosplayYMDDmomotaro video publishingasakusa is jiroyoung peachYMDD-101YMDD101ymdd00101



    • JavHD Full is The best Jav censored and uncensored watch online free forever