planning javcensored censored sister creampie




FC2APODEBODLULUMVSDMILKDASDHMNDASDCAWDMARANNPJAUKSHUNTBSTARSAMBICJODNACXGMEMJUFEAWD

2024-01-15
222 min

PTS-512 A Beautiful Sister And A Beautiful Younger Brother/A Beautiful Older Brother And A Beautiful Younger Sister Influencer Try An Erotic Game To Increase The Number Of Views, And They Get Really Horny! Continuous Incestuous Creampie LIVE Broadcas

  • hiiragi yuuki onodera mai censoredcreampiesisterPTSpetersPTS-512PTS512h-021pts00512
    • 2023-11-09
    260 min

    MFOD-019 A Younger Sister Who Broke Her Older Brother"s Precious Real Doll. Big Pinch! If This Happens, I Have No Choice But To Pretend To Be A Doll And Survive! ？ What Will Be The End？ !

  • censoredcreampiecosplayMFODworks faleno tubeMFOD-019MFOD0191mfod00019
    • 2021-10-20
    121 min

    [IMOTA-009]My Little Stepsister Has Grown Into A Sexy Woman And Now She"s Wearing A Miniskirt And Exposing Her Bare Legs And Blowing My Mind Into A Fully Hard Erection!

  • aimi aya mamiya censoredcreampiesisterIMOTAstar paradiseimouto tamagoIMOTA-009IMOTA009h-254imota00009
    • 2021-10-01
    149 min

    [SSPD-166]Harem Planning To Win Over Two Beautiful Girls From My Part-Time Job. Nanami Kawakami Hikari Ninomiya

  • kawakami nanami hikari ninomiya censoredcreampieSSPDattackersnikusonsuper specialSSPD-166SSPD166sspd00166
    • 2021-06-12
    122 min

    [SCOP-725]This Gal Was Wearing A Hoodie At Home But Not Wearing A Bra Or Panties And Totally Had Her Guard Down!! Even Though They Were StepB****************r, He Couldn't Control His Lust And In the End They Had Fakecest: Creampies Sex!! 2

  • censoredcreampiesisterSCOPscoopk taromousouzokuSCOP-725SCOP725scop00725
    • 2020-12-11
    143 min

    [SCOP-697]彼女の家で遊んでてトイレに行ったらまさかの彼女のお姉ちゃんとバッタリ！ボクの巨チンをいきなり見た彼女のお姉ちゃんが興奮してパクリ！そのまま彼女に内緒でお姉ちゃんと内緒でセックスしちゃいました

  • censoredcreampieSCOPk m producekuwatchiscoop kmpSCOP-697SCOP697h-565scop00697
    • 2020-08-14
    113 min

    [VRTM-510]This Repressed Huge Tits Private Tutor Teased Me Over And Over With Pull Out Sex Behind My Parents' Backs

  • sachiko ena koume censoredcreampiebig titsVRTMv r producegoro koenjiVRTM-510VRTM510h-910vrtm00510
    • 2020-07-10
    114 min

    [VRTM-512]Sister Brainwashed And Turned Into Stepdad's Toys... 3

  • kanon kanon kiyoshi saki censoredcreampiesisterVRTMv r produceryo inugamiVRTM-512VRTM512h-910vrtm00512
    • 2020-07-04
    230 min

    [HUNTA-800]My Brother Is Planning To Marry His Girlfriend Of 2 Years. But He Doesn't Know That I've Been Creampie Fucking Her For A Year And A Half.

  • censoredcreampieHUNTAhunterkawajirihhh groupHUNTA-800HUNTA800hunta00800
    • 2020-06-12
    119 min

    [MDTM-643]The Story Of Making A Baby With My Sensitive Step-sister Who Cums So Fast On Her Ovulation Day Aida Usagi ACT. 008

  • aika usagi censoredcreampieuniformMDTMspace planningtodoMDTM-643MDTM643h-585mdtm00643
    • 2020-06-12
    124 min

    [VRTM-506]"We Can't Do Anything Nasty, But I'll Teach You How To Kiss!" Oral Fuck Between A Virgin Stepbrother And His SK**led At Kissing Older Stepsister! Both Their Melting Kisses Lead To Her Pussy Dripping Wet With Ejaculate, And H

  • sakuraba hikari moe minami censoredcreampiebig titsVRTMv r produceolive yoshidaVRTM-506VRTM506h-910vrtm00506
    • 2020-05-15
    108 min

    [VRTM-498]This Little Stepbrother Couldn't Take The Strain Of Being Celibate While Being Hospitalized, So When He Gave His Big Ass Big Stepsister (A Nurse) Some Aphrodisiacs, She Started Flashing Panty Shot Action And Rubbing Her Dripping Wet Cun

  • moe minami sakuraba hikari censoredcreampiesisterVRTMv r producegoro koenjiVRTM-498VRTM498h-910vrtm00498
    • 2020-04-10
    120 min

    [VRTM-494]"It's Been A Long Time Hasn't It..." Hiding Under The Bed Covers With That C***dhood Friend You Used To Flirt With - Hot And Sweaty SEX Licking Each Other All Over, Holding Each Other Tight While Fucking And Giving Her A Cre

  • mitani akari hasumi claire censoredcreampieVRTMv r producegoro koenjiVRTM-494VRTM494h-910vrtm00494
    • 2020-02-14
    122 min

    [VRTM-481]Sister Brainwashed And Turned Into Stepdad's Toys... 2

  • yui nagase toua kotone censoredcreampiesisterVRTMv r produceolive yoshidaVRTM-481VRTM481h-910vrtm00481
    • 2019-12-13
    121 min

    [VRTM-469]Unable To Endure Celibacy While Hospitalized, This Stepson Gave His Big Ass Stepmom Nurse Some Aphrodisiacs And Then She Rubbed Her White Pantyhose Against Him And A Stain Began To Develop On Her Panties, And Then She Locked Her Legs Around

  • manami oura kana morisawa kanako iioka censoredcreampiesisterVRTMv r producegoro koenjiVRTM-469VRTM469h-910vrtm00469
    • 2019-12-13
    119 min

    [VRTM-471]This Kind And Gentle Big Ass Big Stepsister Was Wearing A Tight Skirt And Exerted Her Total Domain Over A Horny Little Stepbrother! When She Was Given Aphrodisiacs, She Started To Rub Her Knee-High Socks Against Him And Dripped Juicy Stains

  • nanako miyamura ririka censoredcreampiesisterVRTMv r producegoro koenjiVRTM-471VRTM471h-910vrtm00471
    • 2019-10-24
    64 min

    [HYPN-009]Hypnotism Rental I'm A Freelancer And My Little Stepsister Thinks I'm A Loser, So I Put Her Under Hypnotism And Transformed Her Into A Pervert! The Item: A Hypnotism Rattle Ruka Aise

  • ruka aise censoredcreampieblowjobHYPNsod createeasy matsumotomind control coHYPN-009HYPN0091hypn00009
    • 2019-09-13
    119 min

    [MDTM-563]Fucking My Super Sensitive Stepsister On Her Dangerous Day - Riona Mana 002

  • mana rio censoredcreampiebeautiful girlMDTMmedia stationtodospace planningMDTM-563MDTM56361mdtm00563
    • 2019-09-13
    121 min

    [VRTM-453]This Little Brother-In-Law Is Lusting For His Kind And Gentle Big Ass Big Sister-In-Law Who Wears A Tight Skirt! When He Gave Her Aphrodisiacs To Drink She Started Rubbing Her Knee-High Socks Up Against Him And Staining Her Panties, And The

  • otsuki sound yuki sakuragi censoredcreampiesisterVRTMv r producerokutanzo no seishiVRTM-453VRTM453h-910vrtm00453
    • 2019-09-13
    107 min

    [VRTM-452]"Oh My... You Aren't Trying To Lure Me To Temptation, Are You...？" He Was Alone In The House With His Big Brother's Girlfriend, And All She Was Wearing Was A Single Button-Down Shirt, And No Bra Over Her Big Tits! He Could S

  • anne mashiro hamazaki mao censoredcreampiebig titsVRTMv r produceken hosokawaVRTM-452VRTM452h-910vrtm00452
    • 2019-07-12
    301 min

    [VRTM-443]V&R 2018 Firs Half Highlights

  • censoredcreampiebig titsVRTMv r produceVRTM-443VRTM443h-910vrtm00443
    • 2019-07-12
    151 min

    [SCOP-638]This Neighborhood Elder Sister Is An Exhibitionist Who Likes To Prance Around Her Room Scantily Clad, And I Can See Her Titties Peeking Out From The Side Of Her Shirt, And It's Too Much For Me To Handle! I Tried To Control My Excitement

  • censoredcreampiebig titsSCOPscoopk taromousouzokuSCOP-638SCOP638h-565scop00638
    • 2019-07-12
    118 min

    [VRTM-440]"Oh My... You Aren't Trying To Lure Me To Temptation, Are You...？" He Was Alone In The House With His Big Brother's Girlfriend, And All She Was Wearing Was A Single Button-Down Shirt, And No Bra Over Her Big Tits! He Could S

  • kurata mao anju minase censoredcreampiebig titsVRTMv r produceken hosokawaVRTM-440VRTM440h-910vrtm00440
    • 2019-05-17
    141 min

    [VRTM-429]She's Only Wearing Hot Pants, But She's Not Wearing Panties! Seeing Flashes Of His Older Stepsisters Cunt, This Cherry Boy Little Stepbrother Is Suddenly Rock Hard! Unable To Hold Back, He Jumps His Stepsister For A Quickie! His Fir

  • akemi miu ayumi reika censoredcreampiesisterVRTMv r produceyamanaka socksVRTM-429VRTM429h-910vrtm00429
    • 2019-04-11
    245 min

    [SDAM-015]Cherry Boy Little Stepbrother Touches His Mature Older Stepsisters Body And Gets Hard Even Know He Knows Its Wrong, Will It Turn Into "Forbidden Fakecest" Or What？! 9

  • censoredcreampiesisterSDAMsod createyazawa ready to receiveSDAM-015SDAM0151sdam00015
    • 2018-11-22
    153 min

    [NHDTB-202]I Begged My Sister-In-Law To Have Sex With Me And It Felt So Good So I Forcibly Gave Her A Creampie In The Piledriver Position

  • censoredcreampieNHDTBnatural highlemonheart nakajimaNHDTB-202NHDTB2021nhdtb00202
    • 2018-11-09
    138 min

    [VRTM-392]"I Just Want To Touch Them Once!" A Naughty Big Brother Slips His Little Sister Some Sleeping Pills While She's Wearing Her Track Shorts So He Can Fondle Her Big Booty... And Give Her His Creampie! 3

  • aoi kururugi nimo censoredcreampiebig titsVRTMv r producesunao tanakaVRTM-392VRTM392h-910vrtm00392
    • 2018-11-08
    165 min

    [NHDTB-199]Smearing Herself With Her Beloved Brother's Cum. Not Satisfied With Just Masturbation, A Big Sister Pushes Her Brother Down And Begs For A Creampie

  • censoredcreampieslutNHDTBnatural highkansukeNHDTB-199NHDTB1991nhdtb00199
    • 2018-10-25
    119 min

    [RCTD-156]If You're Her Big Brother, You Should Know What Yuor Little Sister Looks Like Naked! Pregnancy Fetish Candid Camera Live Edition

  • censoredcreampiesisterRCTDrockettaro kanbeRCTD-156RCTD1561rctd00156
    • 2018-09-28
    256 min

    [SKMJ-007]The Serious Amateur Support Project This Kind And Gentle Big Sister Was Worried About Leaving Her Cherry Boy Little Brother When She Was About To Get Married Before She Would Consummate Her Marriage With Her Fiance, She Needed To Give Her L

  • censoredcreampiesisterSKMJred face girlyuseiSKMJ-007SKMJ007h-1324skmj00007
    • 2018-09-14
    199 min

    [SCPX-298]My Big Sister Is So Prim And Proper That Whenever I Make Dirty Jokes Her Face Gets Deep Red She's Really Pretty But She Never Seems To Have A Boyfriend, So I Teased Her And Said, "You Must Be A Virgin" And It Turns Out That She

  • censoredcreampiesisterSCPXk m produceyo sukemousouzokuSCPX-298SCPX298h-565scpx00298
    • 2018-08-10
    167 min

    [SCPX-291]Our Parents Swapped Partners And Got Remarried!？ I Suddenly Ended Up With A New Little Sister And Now We're Living Together! Our Crazy Parents Like To String Us Along, But Gradually, My New Sister And I Started Getting Feelings For Each

  • censoredcreampiebeautiful girlSCPXk m produceyo sukeSCPX-291SCPX291h-565scpx00291
    • 2018-07-12
    101 min

    [SDDE-545]- A TV Program Where Sex Is Part of The Show - The "Always Fucking" Suspense Theater

  • yui hatano hamazaki mao censoredcreampiedramaSDDEsod createkimura shinyaSDDE-545SDDE5451sdde00545
    • 2018-06-08
    299 min

    [VRTM-362]V & R 2017 Second Half Greatest Hits Collection

  • censoredcreampiebig titsVRTMv r produceVRTM-362VRTM362h-910vrtm00362
    • 2018-03-23
    157 min

    [SCOP-500]My Bitchy Little Sister Always Teases Me, Calling Me, "Cherry Boy, Cherry Boy!" But Then I Found Out That She Was Working At A Maid Body Washing Reflexology Salon!! Once I Found Out Her Secret, I Could Take Advantage, So What Will H

  • censoredcreampiesisterSCOPk m producekuwatchiSCOP-500SCOP500h-565scop00500
    • 2018-03-21
    147 min

    [IENE-877]Creampie Sex With An Ultra Sensual Big Sister-In-Law! "You Can Stick It In If You Use A Condom" But It Started To Feel So Good You Secretly Slipped Off That Rubber And Began Fucking Her Raw And Then She Revealed Her True Identity As

  • censoredcreampieslutIENEie nergybanbi no purinIENE-877IENE8771iene00877
    • 2018-03-21
    163 min

    [IENE-876]I Played Some Pranks On My Schoolgirl Little Sister While She Slept, But Then She Demanded Raw Creampie Sex, And When I Was About To Cum, She Locked Her Legs Around Me And Wouldn't Let Me Escape, So I Creampie Ejaculated My Load Into He

  • abe mikako yuna yamakawa censoredcreampieslutIENEienergyIENE-876IENE8761iene00876
    • 2018-03-09
    122 min

    [VRTM-338]"I Want To Have My Big Brother's Baby!" When This Little Sister Suddenly Cums To Her Favorite Big Brother's Home, She Unexpectedly Finds His Fiancee There Too... Unwilling To Let His Little Sister Fuck Her Husband, She Gives

  • sena ai blue censoredcreampiesisterVRTMv r produceken hosokawaVRTM-338VRTM338h-910vrtm00338
    • 2018-03-08
    121 min

    [NHDTB-098]When I Forcefully Fucked My Little Sister's Pussy It Felt So Good That I Couldn't Stop Pounding It Even After I Gave Her A Creampie, And It Started Bubbling With Pussy Juice And Cum And Was Dribbling All Over The Place 3

  • censoredcreampiesisterNHDTBnatural highremonha to nakashimaNHDTB-098NHDTB0981nhdtb00098
    • 2018-03-08
    145 min

    [IENE-870]Incest Cherry Boy Sex! This Big Sister Got Drunk And Horny, But One Cum Shot Wasn't Going To Be Enough! She Kept Screaming, "Please Stop!" But I Chased Her Around And Kept On Creampie Fucking Her!

  • censoredcreampiesisterIENEie nergybanbi no purinIENE-870IENE8701iene00870
    • 2018-02-09
    148 min

    [VRTM-325]"Hey Big Brother, You Can Do It!" When Her Big Brother Lost Confidence In Himself, His Cheerleader Little Sister Tries To Cheer Him Up, But When He Catches A Glimpse Of Her Ass Underneath Her Skirt, He Gets Rock Hard! Hoping To Make

  • sena ai aya miyazaki censoredcreampieschoolgirlVRTMbuoy and earl produceheavy smoky ishiiVRTM-325VRTM325h-910vrtm00325
    • 2018-02-09
    138 min

    [VRTM-330]My Big Sister Came To Help Me Move And I Got Hot And Horny Over Her Hot Pants Outfit! When This Little Brother Could No Longer Resist Her Big Ass Bulging Out Of Her Pants He Slipped It In From Behind! He Pumped That Ass And Gave Her A Sonic

  • mandarin orange aya miyazaki censoredcreampiesisterVRTMv r produceyamanaka socksVRTM-330VRTM330h-910vrtm00330
    • 2018-01-25
    135 min

    [SDMU-765]This Little Brother Has A Crush On His College Girl Big Sister, So She Pretended To Miss The Last Train Home, And They Spent The Night In A Love Hotel For The First Time Ever, And She Decided To Lure His Cherry Boy Ass To Temptation When He

  • censoredcreampieamateurSDMUsod createakira saijoSDMU-765SDMU7651sdmu00765
    • 2018-01-11
    195 min

    [NHDTB-079]My Big Sister Was A Cold Fish When I Fucked Her Pussy, So When I Pretended To Make A Mistake And Gave Her Anal Sex She Suddenly Spasmed With Pleasure! She Kept Cumming But I Ignored Her And Kept On Thrusting In This Orgasmic Anal Creampie

  • censoredanalcreampieNHDTBnatural highbacon tanakaNHDTB-079NHDTB0791nhdtb00079
    • 2017-12-08
    120 min

    [DOHI-062]I Just Moved In, And My New Neighbors Are Sisters With Colossal Tits! These Sisters Had No Boyfriends Or Sex Partners, So They Were Ultra Horny, And Were Luring Me To Temptation With Their Exposed Cleavage, And Ready To Have Sex, Even With

  • yuka asami akira hikaru censoredcreampiebig titsDOHIoffice k smaboroshikoinsertDOHI-062DOHI06236dohi00062
    • 2017-11-02
    216 min

    [NHDTB-053]I Was In The Hospital, And I Couldn't Ask My Mother To Take Care Of My Sexual Needs, So When My Auntie Came To Visit Me, I Asked Her Instead, And She Kindly And Gently Gave Me A Secret Cowgirl 15 Creampie Specials

  • censoredcreampieNHDTBnatural highremonha to nakashimaNHDTB-053NHDTB0531nhdtb00053
    • 2017-10-01
    145 min

    [GDHH-074]A Fake Audition For Young Actresses This Young Up-And-Cumming Beautiful Actress Is In The Final Rounds Of This Fake Audition For A TV Drama, And She Has To Withstand The Sexual Harassment Of The Judges! But Still, She Wants This Chance And

  • censoredcreampieGDHHgolden timekorosukehhh groupGDHH-074GDHH074gdhh00074
    • 2017-09-08
    188 min

    [VRTM-286]Big Brother Is Into His Little Sister And, Without The Parents Knowing, Grabs A Camera And Asks Her To Fuck Him! While She's Embarrassed About Being Filmed Doing Incest, It Also Feels So Good That She Starts Grinding Hard And Cumming Bu

  • asada yuri ai minano censoredcreampiesisterVRTMv amp r producetsubuyaki jiroVRTM-286VRTM286h-910vrtm00286
    • 2017-09-01
    335 min

    [AVOP-310]I Suddenly Had A New Cute Little Sister-In-Law! And When I Transferred To My New Little Sister's School, I Found Out That I Was Surrounded By Girls And Was The Only Boy In Class!

  • censoredcreampieschoolgirlAVOPhunterkawajiriav open 2017AVOP-310AVOP310avop00310
    • 2017-09-01
    199 min

    [AVOP-306]When I Ordered A Call Girl Service My Big Sister Came To My Door! In The End, I Secretly Had Creampie Sex With All 4 Of Them 9

  • tomomi hoshisaki yuzu kitagawa censoredcreampiesisterAVOPglayzupdatingAVOP-306AVOP30612avop00306
    • 2017-06-01
    157 min

    [IENE-786]We Heard That This Busy Train Station Was Overflowing With Drunk Ladies On The Weekend Who Missed The Last Train home, And We Went Picking Up Girls And Found These Two! So We Took Them Home For Some Serious Sex

  • censoredcreampieIENEienergyrakudaie nergyIENE-786IENE7861iene00786
    • 2017-05-12
    170 min

    [VRTM-259]My Big Sister Came To Help Me Move And I Got Hot And Horny Over Her Hot Pants Outfit! When This Little Brother Could No Longer Resist Her Big Ass Bulging Out Of Her Pants He Slipped It In From Behind! He Pumped That Ass And Gave Her A Sonic

  • yuri sasahara yuki sakuragi censoredcreampiesisterVRTMv r produceyamanaka socksVRTM-259VRTM259h-910vrtm00259
    • 2017-05-12
    194 min

    [VRTM-258]"I Want To Have My Big Brother's Baby!" When This Little Sister Suddenly Cums To Her Favorite Big Brother's Home, She Unexpectedly Finds His Fiancee There Too... Unwilling To Let His Little Sister Fuck Her Husband, She Gives

  • mari rika asada yuri censoredcreampiesisterVRTMv r produceken hosokawaVRTM-258VRTM258h-910vrtm00258
    • 2017-04-21
    174 min

    [MEI-017]On The Other Side Of That One Way Mirror Is A Single Mother MILF! A Mother/ Child at Home Family This Brother And Sister Are Trying To Earn Their Tuition Through The Sex And Creampie Raw Footage Challenge! This Beautiful Big Sister Is Drippi

  • censoredcreampieamateurMEIprestigedont knowmeikyo shisuiMEI-017MEI017118mei00017
    • 2017-03-10
    212 min

    [VRTM-238]"Hey Big Brother, You Can Do It!" When Her Big Brother Lost Confidence In Himself, His Cheerleader Little Sister Tries To Cheer Him Up, But When He Catches A Glimpse Of Her Ass Underneath Her Skirt, He Gets Rock Hard! Hoping To Make

  • asada yuri yukari miyazawa censoredcreampieschoolgirlVRTMv r producekitorune kawaguchiVRTM-238VRTM238h-910vrtm00238
    • 2017-03-03
    144 min

    [DOHI-045]Titty G Spot Big Tits Babes Who Lose Their Mind With Cumtastic Pleasure When They Get A Massage On Their Mammary Glands

  • sunao megumi rina ayana akari nanara censoredcreampiebig titsDOHIoffice k s96insertDOHI-045DOHI04536dohi00045
    • 2017-02-10
    122 min

    [MDB-758]Nude Maid Harlem Creampie Specials Lulu Aizawa Umi Hirose Sora Shiina Asahi Mizuno

  • serizawa ruru umi hirose censoredcreampieblowjobMDBmedia stationoosaki hirokoujiMDB-758MDB75861mdb00758
    • 2017-01-13
    207 min

    [VRTM-223]This Schoolgirl With An Innocent Face Is A Big Ass Little Sister Who I Worry About Because Her Sexuality Is Unequaled ! She's So Horny She'll Even Ride Her Big Brother's Cock And Look Down On Him As She Teases Him With Dirty Tal

  • atomi shuri aya miyazaki censoredcreampieschoolgirlVRTMv amp r producekitorune kawaguchiVRTM-223VRTM223h-910vrtm00223
    • 2017-01-06
    157 min

    [SDABP-003]"Please Squirt All Of Your Cum Inside Me" Ai Minano A Spoiled Little Sister Is Providing Creampie Baths For Older Brother Only

  • ai minano censoredcreampiesisterSDABPsod createnishinakashima nanpouSDABP-003SDABP0031sdabp00003
    • 2016-10-14
    174 min

    [VRTM-200]"I Want To Have My Big Brother's Baby!" When This Little Sister Suddenly Cums To Her Favorite Big Brother's Home, She Unexpectedly Finds His Fiancee There Too... Unwilling To Let His Little Sister Fuck Her Husband, She Gives

  • aya miyazaki kanna misaki censoredcreampiesisterVRTMv amp r producehosokawa kenVRTM-200VRTM200h-910vrtm00200



    • JavHD Full is The best Jav censored and uncensored watch online free forever