shame high vision censored prank jav




FC2MEYDAVSANNPJSQTESPRDSHKDRBDJUFEHMNHNDHDKACAWDCESDPREDSSISAPODAMBIHODVJULAUKS

2022-02-22
122 min

[NUBI-060](Shame In The Bookstore) This College Girl Was Getting Fondled, And You Could See The Desire In Her Eyes. Her Pussy Was Dripping Wet And Waiting For His Rock Hard Cock To Enter Her And Send Her To Creampie Orgasmic Ecstasy

  • censoredsquirtingblowjobNUBIkalimantannubiaNUBI-060NUBI060h-1112nubi00060
    • 2022-02-19
    134 min

    [AGMX-112]Illustrated Guide to Nakedness in 2032 vol. 3

  • censoredamateurAGMXsex agent daydreamersyosukesex agentAGMX-112AGMX112agmx00112
    • 2021-12-28
    99 min

    [NUBI-058](Acts Of Shame In The Bookstore) A College Girl Is Shamed In The Bookstore His Rock Hard Cock Entered Her Dripping Wet Cunt, And She Started Massively Squirting

  • censoredsquirtingblowjobNUBIkarimantannubiaNUBI-058NUBI058h-1112nubi00058
    • 2021-12-25
    300 min

    [KSAT-052]Hooking Up S********l. I Grabbd A Girl In Uniform. 5 Hours.

  • censoredschoolgirlKSATstrong woman s table daydream tribetable of a strong womanKSAT-052KSAT052ksat00052
    • 2021-04-22
    124 min

    [FSDSS-207]Getting Up Close And Personal With Views Of A Huge Ass! Minori Kawana

  • real village henan censoredbeautiful girlsingle workFSDSSfalenotake dfaleno starFSDSS-207FSDSS2071fsdss00207
    • 2021-04-20
    97 min

    [NUBI-050](The Theater Of Shame) These Innocent Girls Are Getting Shamed And Getting Their Nipples Erect With Excitement! And When They Get Their Pussies Teased, They Start To Leak With Shameful Pussy Juice! They'll Fall Madly In Love With You Wh

  • censoredcreampieamateurNUBIkalimantannubiaNUBI-050NUBI050h-1112nubi00050
    • 2021-02-25
    120 min

    [FSDSS-177]If You Get Caught, You're Out! We Pretended To Be A Couple And Entered This Establishment, Undercover! Dripping With Adrenaline The Ultimate Real And Silent Sex At A Business Establishment, While They're Still Open For Business Tin

  • nanami tina censoredsingle workFSDSSfalenoponyfaleno starFSDSS-177FSDSS1771fsdss00177
    • 2021-02-23
    132 min

    [SDAB-166]Relentless, Licking Kisses Saya Kuriyama

  • saya kuriyama censoreduniformsingle workSDABsodgoemonyouthSDAB-166SDAB1661sdab00166
    • 2020-11-19
    120 min

    [PPPD-887]College Girl With Big Tits Gets Wet At An Adult VR Booth! Her Pussy's So Soaked She Doesn't Even Notice A Cock Inside Her, But Her Orgasms Are Totally Real!

  • censoredbig titsPPPDoppaiPPPD-887PPPD887pppd00887
    • 2020-10-22
    126 min

    [RCTD-360]True: Wristwatch That Makes Time Stop Part 19 - Asaka Sera

  • asaka sera censoredbig titssingle workRCTDrocketroute yamazakiRCTD-360RCTD3601rctd00360
    • 2020-09-01
    193 min

    [DKSB-077]A Teacher And S*****t The Forbidden School An Ultra Deep And Rich Lesbian Series Special

  • censoredschoolgirllesbianDKSBoffice k sk s bestDKSB-077DKSB07736dksb00077
    • 2020-08-16
    107 min

    [DDK-198]Hey Little Lady, How About A Little Fun？ You've Got Nothing To Lose Anyway. These Dirty Old Middle-Aged Men Were So Relentless And Stubborn In The Way They Fucked Ichika Kasagi

  • kasagi ichika censoredsingle workDDKdogmanormal kimDDK-198DDK198ddk00198
    • 2020-07-01
    119 min

    [FLB-046]Twist Their Dirty-Girl Nipples 'Till They Cum vol. 2

  • censoredamateurFLBsarutoru video publisherfetish labFLB-046FLB046h-897flb00046
    • 2020-06-14
    479 min

    [HHAT-003]Nip Slips And Panty Shot Action Galore! These Amateur Girls Lost The Game And Had To Have Sex 480 Minutes Season 3

  • censoredHHATatomhhh groupHHAT-003HHAT003hhat00003
    • 2020-04-28
    117 min

    [EQ-516]Old Ladies! Please Pump My Cock! Mature Woman Ladies Who Lust For Masturbating Men 8

  • censoredcreampiebig titsEQbullittshinobu kamezufetish specialtyEQ-516EQ516h-100eq00516
    • 2020-03-12
    125 min

    [RCTD-313]New: The Watch Part That Stops Time. 16

  • tsugumi morimoto nimo censoredRCTDrocketroute yamazakiRCTD-313RCTD3131rctd00313
    • 2020-02-28
    241 min

    [SCOP-663]「今日エッチなんてするつもりなかったのに…」無防備な極上美女に迫るハプニングSEX40人4時間 3

  • censoredcreampieSCOPscoopk taroSCOP-663SCOP663h-565scop00663
    • 2019-12-26
    109 min

    [NHDTB-351]Caught On A Packed Train With A Group Of Boys, She Gets Caught Up In A Naughty Game That Makes Her Cum Until Her Legs Give Out

  • censoredNHDTBnatural highlemonheart nakajimaNHDTB-351NHDTB3511nhdtb00351
    • 2019-11-18
    117 min

    [AVSA-112]Breaking In With A Chastity Belt After 30 Days Of Abstention, We Had Explosive Sex This Office Lady Was Made By Her Sadistic Pimp Boyfriend To Wear A Chastity Belt Reiko Kobayakawa

  • kobayakawa reiko censoredbig titsmature womanAVSAavs collector siceman ochiaiavscollector sAVSA-112AVSA112avsa00112
    • 2019-11-14
    235 min

    [AP-715]Schoolgirl "Total Domain" Prank Body Measurement

  • censoredcreampieschoolgirlAPapachebarracudahhh groupAP-715AP715ap00715
    • 2019-10-12
    168 min

    [ATOM-391]Her Clothes Are Almost Falling Off! You Can Even See Her Pussy! - Amateur Girls In Kimonos At A Resort Hotel! - Playing Statues In Just A Towel! - Who Will Win The Obstacle Race？

  • censoredATOMatomkari daigoinhhh groupATOM-391ATOM391atom00391
    • 2019-09-24
    93 min

    [NMK-044]Amateur Bellybutton Footage Collection vol. 4

  • censoredamateurNMKnorimasa studioNMK-044NMK044h-897nmk00044
    • 2019-09-14
    221 min

    [ATOM-389]You're Suddenly Being Sexually Assaulted, Can You Resist The Thrill And Place The Dominoes In Place!？ Drunk Amateur Girls Only! These Girls Are Being Buzzed By A Remote Control Vibrator While Trying To Play The Domino Game

  • censoredATOMatomkari daigoinhhh groupATOM-389ATOM389atom00389
    • 2019-08-16
    234 min

    [ATOM-387]Mission: Make Her Pussy Quiver! Watch Her Take An Iron Rod To The Crotch

  • censoredATOMatomkari daigoinhhh groupATOM-387ATOM387atom00387
    • 2019-08-16
    240 min

    [ATOM-386]Consecutive Panty Shot Action And Nip Slips! Amateurs Only! Let's Play A Game: You're Tied Up And They're Playing Pranks On You, But You Can't Make A Sound

  • censoredATOMatomkari daigoinhhh groupATOM-386ATOM386atom00386
    • 2019-08-03
    180 min

    [ATOM-385]Quiz Time! A Piece Of Tape Gets Torn Off For Every Wrong Answer, Revealing These College Students' Tits And Pussies!

  • censoredATOMatomkari daigoinhhh groupATOM-385ATOM385atom00385
    • 2019-07-26
    240 min

    [OKAX-532]Real Amateur Pranks! Sudden Sexual Happenings... Pranks, Shame, Sexual Harassment, Tricked And Made To Take Off Their Clothes... 4 Hours

  • censoredamateurbeautiful girlOKAXk m producedick mandokuokazuOKAX-532OKAX53284okax00532
    • 2019-07-13
    233 min

    [ATOM-383]The Brush Spins On Their Nipples! A New Weapon! Quiz! Nipple Drill Time Shock 2

  • censoredATOMatomkari daigoinhhh groupATOM-383ATOM383atom00383
    • 2019-07-04
    240 min

    [ATOM-382]Spilling Out! Blindfolded Grinding Game Show You Feel With Your Pussy

  • censoredATOMatomkari daigoinhhh groupATOM-382ATOM382atom00382
    • 2019-07-04
    206 min

    [ATOM-381]Spilling Out All Over! Amateurs Only! Running Quiz In Microbikini

  • censoredATOMatomwhatta gianthhh groupATOM-381ATOM381atom00381
    • 2019-06-15
    229 min

    [ATOM-380]Amateurs Only! Tickled Until They Lose! You Lose Even If You Avoid With Your Groin! Groin Splitting Pussy Tightrope

  • censoredATOMatomkari daigoinhhh groupATOM-380ATOM380atom00380
    • 2019-06-15
    192 min

    [ATOM-379]Pussy Handwriting Competition With Vibrator During Sexy Stimulation

  • censoredATOMatomkari daigoinhhh groupATOM-379ATOM379atom00379
    • 2019-06-01
    201 min

    [ATOM-378]Pay Off 1 Million Yen Of Debt! Remote Controlled Vibrator! Electrifying Challenge

  • censoredATOMatomwhatta gianthhh groupATOM-378ATOM378atom00378
    • 2019-05-16
    203 min

    [ATOM-375]Amateurs Only! Win The Big Cash Prize! Find The Remote For The Remote-Controlled Vibrator

  • censoredATOMatomwhatta gianthhh groupATOM-375ATOM375atom00375
    • 2019-05-16
    231 min

    [ATOM-374]Panty Shot Action Guaranteed! Nip Slips Required! Amateur Ladies Only! Ladies Get Their Dresses Tied Over Their Heads The Time Shock Quiz 2

  • censoredbig titsATOMatomkari daigoinhhh groupATOM-374ATOM374atom00374
    • 2019-05-10
    241 min

    [HEZ-044]These Bad Boys Played Some Pranks And Fucked This Housemaid An Elder Sister Home Helper 12 Girls

  • censoredHEZhot entertainmentHEZ-044HEZ04459hez00044
    • 2019-04-10
    207 min

    [EQ-448]Let Me Help You Jack Off! Cute Girls Grip Your Dick And Help You Ejaculate 6

  • censoredbig titsblowjobEQbullittshinobu kamezushameEQ-448EQ448h-100eq00448
    • 2019-02-10
    244 min

    [EQ-437]Shady Amateur Pickups Special. Please! Let Me Have Intercrural Sex With You! When A Bare, Rock Hard Dick Rubs Against Their Pussies, The Girls Get Wet. We Slip Inside Their Slippery Pussies! 15 Girls, 4 Hours 2

  • censoredbig titsamateurEQbullittitazuraEQ-437EQ437h-100eq00437
    • 2019-01-24
    220 min

    [DANDY-644]"I Caught My Lady Boss Touching Her Sleeping Drunk Colleague's Cock, And Now That I Had Her Trapped, I Fucked Her All Night All The Way Until It Came Time To Go Back To Work" vol. 1

  • censoreduniformDANDYdandysplash kinoshitaDANDY-644DANDY6441dandy00644
    • 2019-01-17
    221 min

    [ATOM-362]My Pussy's So Wet! Not-Stop Squirting Action! Amateur Couples Only! A Finger-Banging Quiz Frenzy, Live On Air With Their Boyfriends

  • censoredATOMatomkari daigoinhhh groupATOM-362ATOM362atom00362
    • 2019-01-10
    185 min

    [EQ-436]Old Ladies! Please Pump My Cock! Mature Woman Ladies Who Lust For Masturbating Men 4

  • censoredbig titsamateurEQbullittshinobu kamezushameEQ-436EQ436h-100eq00436
    • 2018-12-15
    240 min

    [MCSR-327]Old-School Thai Massage Voyeur Ultra Exquisite Colossal Tits Special! 4 Hours/16 Ladies!

  • censoredcreampieMCSRbig morkaltakeshinmascottMCSR-327MCSR32757mcsr00327
    • 2018-12-13
    228 min

    [ATOM-355]Amateur Young Ladies Waiting For Her Boyfriend Only! How Would You Like To Play A Naughty Game While You Talk To Your Boyfriend On The Phone For A Chance To Win A Cash Prize？ Office Ladies

  • censoredATOMatomwhatta gianthhh groupATOM-355ATOM355atom00355
    • 2018-12-13
    479 min

    [ATOM-358]Featuring 2 Brand New Titles! Panty Shots! Downblouse Shots Are Par For The Course! 26 Sexy Girls. Featuring [26 Types] Of Games! Season 4

  • censoredATOMatomhhh groupATOM-358ATOM358atom00358
    • 2018-12-10
    131 min

    [REQ-428]Let Me Help You Jack Off! Cute Girls Grip Your Dick And Help You Ejaculate 5

  • censoredbig titsblowjobREQbullittshinobu kamezushameREQ-428REQ428h-100req00428
    • 2018-11-17
    185 min

    [ATOM-351]Lots Of Nip Slips! Their Pussies Are Exposed Too!？ Win The $10,000 Cash Prize! Amateurs In Yukata We Found At The Hot Spring Inn Only! Slippery Bodies Wearing Nothing But A Towel! Would You Like To Play A Game Of Lotion Statues？

  • censoredATOMatomwhatta gianthhh groupATOM-351ATOM351atom00351
    • 2018-11-17
    223 min

    [ATOM-354]No Matter How Much Pleasure You Feel Or How Wet You Get, You Have To Remember! Amateurs Only! Who Will Be Crowned Queen Of Fixed Vibrator Memorization!？

  • censoredamateurATOMatomkari daigoinhhh groupATOM-354ATOM354atom00354
    • 2018-11-17
    215 min

    [ATOM-352]With Their Swimsuits Melting, You're Guaranteed Some Nip Slips! Pussy Slips Are Inevitable! Take Advantage Of The Confusion And Fuck Them!？ Amateurs Only! A Slippery Soapland Experience With Melting Swimsuits!

  • censoredATOMatomkari daigoinhhh groupATOM-352ATOM352atom00352
    • 2018-11-10
    136 min

    [RHE-616]This Handjob Angel Will Look Into Your Eyes As She Throttles Your Cock She's Embarrassed But This Amateur Babe Will Stare Into Your Eyes While She Does It!

  • censoredamateurblowjobRHEhot entertainmentmamorudish the fetishRHE-616RHE61659rhe00616
    • 2018-10-18
    183 min

    [ATOM-347]She'll Panty Shot Seduce You, And Serve You Some Nip Slips, But You Must Resist! Milk Splash!! Amateurs Only! Go For The Big Money Prizes! Hold That Milk In Your Mouth As You Endure The Tied Up Tickling Resistance Game!!

  • censoredamateurATOMatomwhatta gianthhh groupATOM-347ATOM347atom00347
    • 2018-10-18
    212 min

    [ATOM-349]Full Panty Shot! Big Tits Amateurs Only! Wanna Try Your Hand At Winning Cash In A Sex Challenge With Your Legs Spread？

  • censoredamateurATOMatomkari daigoinhhh groupATOM-349ATOM349atom00349
    • 2018-10-18
    193 min

    [ATOM-348]Torako The Female Director Presents A Girls' Night Out With No-Holds-Barred Horny Experiences From The Top! From Underneath! Nipples! Areolas! How Well Do You Know Your Titty Sizes!？ If She Gets It Wrong, These Fingers Will Slide Into H

  • censoredamateurATOMatomtorako the female directorhhh groupATOM-348ATOM348atom00348
    • 2018-10-18
    219 min

    [ATOM-350]Only Amateur Girls! Wanna Try Your Hand At Winning Cash By Calling Your Boyfriend While Being Teased With A Big Vibrator？

  • censoredATOMatomkari daigoinhhh groupATOM-350ATOM350atom00350
    • 2018-10-07
    197 min

    [GDHH-121]Amateur Pranks! A Hot Springs Report! We Met These Bikini Gals At A Resort Spa And Asked Them To Accompany Us On A Hot Springs Report Experience And Then We Played Plenty Of Sexy Pranks On Them!

  • censoredGDHHgolden timekiteretsuhhh groupGDHH-121GDHH121gdhh00121
    • 2018-09-16
    243 min

    [OYC-205]Grope Them! Suck It! Fuck All You Want! Schoolgirl Pranks Body Measurement 10 Girls!

  • censoredschoolgirlOYCoyashoku.companyspace nyanjirohhh groupOYC-205OYC205oyc00205
    • 2018-02-16
    242 min

    [ATOM-315]Hone Your Pussy's Sensuality! Amateurs Only! Play The "What's Inside Your Panties!？" Game

  • censoredamateurATOMatomkari daigoinhhh groupATOM-315ATOM315atom00315
    • 2018-02-08
    206 min

    [SDMU-773]The Magic Mirror Number Bus Highly Educated College Girl Babes Hoping To Become A Female Anchor Only! "Would You Like To Receive Training To Become A Female Anchor？" While They Read Their On-Air Copy, They Must Always Look Straight

  • censoredSDMUsod createdainanaSDMU-773SDMU7731sdmu00773
    • 2017-12-15
    136 min

    [DOCP-007]She Was Suddenly Grabbed From Behind And Tit Grabbed And Although She Resisted She Got Horny And Descended Into The Pleasure Of Ecstasy! This Big Tits Sensual Nipple Beautiful Girl Is Getting Her Titties Groped As She Writhes And Moans In M

  • censoredbig titsslutDOCPprestigedoc premiumDOCP-007DOCP007118docp00007
    • 2017-09-07
    178 min

    [SVDVD-619]Shame! She's Buck Naked Underneath Her Apron I'm Being Forced To Work At This Restaurant In Such An Embarrassing Outfit That I Could Die Of Shame 2

  • censoredschoolgirlSVDVDsadistic villagenyu kaji kazamaSVDVD-619SVDVD6191svdvd00619
    • 2017-05-15
    243 min

    [ATOM-281]Amateurs Only! The Pantyless Vibrator Quiz Show

  • censoredATOMatomkari daigoinhhh groupATOM-281ATOM281atom00281



    • JavHD Full is The best Jav censored and uncensored watch online free forever