there is




FC2NGODNACXLULUJUFEMIDVMIDESHKDAWDDTTHDKADASDWAAAGVHCESDAUKGNATRATIDNACRGMEMPRED

2017-10-28
120 min

[JUY-299]This Married Woman Librarian Is Quietly Luring Me To Temptation In The Library Aki Sasaki

  • aki sasaki censoredmature womanslutJUYmadonnabiba gonzoJUY-299JUY299juy00299
    • 2017-10-28
    150 min

    [SSNI-036]The Alluring Total Domain Schoolgirl Enjoy Miniskirt, Knee-High Socks, And Flashes Of Bare Legs Arina Hashimoto

  • there is hashimoto censoredschoolgirlsingle workSSNIs1 no 1 stylemonSSNI-036SSNI036ssni00036
    • 2017-10-28
    119 min

    [JUY-296]My Wife Is Getting Fucked... That Cock Sucking Cock Riding Cuckold Bitch Aya Sazanami

  • sazanami aya censoredmarried womansoloworkJUYmadonnakawaijou osamuJUY-296JUY296
    • 2017-10-28
    150 min

    [KAWD-849]This Sadistic And Perverted Dirty Old Man Is Breaking In A Maso Beautiful Girl With Cum Swallowing And Creampie Sex Ayame Himeno

  • himeno ayame censoredcreampiebeautiful girlKAWDkawaiik c takedaKAWD-849KAWD849kawd00849
    • 2017-10-28
    120 min

    [BLK-336]This Gal Female Teacher Has Monstrous Areolas And Is Teaching At This Titty Fuck Cherry Boy Cherry Popping Academy Nina Nishimura

  • nina nishimura censoredcreampiebig titsBLKkira kiraupdatingBLK-336BLK336blk00336
    • 2017-10-28
    120 min

    [PPPD-604]My Girlfriend's Older Sister Is Luring Me To Temptation With Her Big Tits And Creampie Sex Hana Haruna

  • haruna hana censoredcreampiebig titsPPPDoppaiupdatingPPPD-604PPPD604pppd00604
    • 2017-10-28
    118 min

    [MEYD-310]The Truth Is, I've Been Getting Fucked By My Husband's Boss... Mihina Nagai

  • azumihina nagai mihina censoredsingle workMEYDtameike gorojo asagiriMEYD-310MEYD310meyd00310
    • 2017-10-28
    149 min

    [KAWD-850]The Creampie Ban Is Lifted Cum Crazy Creampie Sex With A Schoolgirl Who Loves Dirty Old Men She's Been Begging For Rich And Thick Sex Mao Oichi

  • maon otoichi censoredcreampieschoolgirlKAWDkawaiicrestKAWD-850KAWD850kawd00850
    • 2017-10-28
    227 min

    [CLUB-423]I Learned That The Bad Girl Who Used To Bully Me Is Now A Beautiful Married Woman Running A Massage Parlor With Some Extra Sensual Services, So I Took Revenge By Having Creampie Sex With Her 7

  • iioka kanako ootsuka ren censoredcreampiemarried womanCLUBhentai shinshi kurabuupdatingCLUB-423CLUB423
    • 2017-10-28
    146 min

    [SSNI-033]Drunk Girl Orgy NTR My Beloved Wife Is Normally A Neat And Clean Lady, But When She Goes To A Drinking Party She Turns Into A Horny Bitch Who Wants To Ride Some Dude's Cock Tsukasa Aoi

  • tsukasa aoi censoredsingle workSSNIs1 no 1 stylemishimaroku saburouSSNI-033SSNI033ssni00033
    • 2017-10-27
    79 min

    [NATR-570]My Sister-In-Law is A Creampie Sexy Costume Non-Nude Erotica Idol Kurea Hasumi

  • hasumi claire censoredsingle workNATRnadeshikoupdatingNATR-570NATR570h-067natr00570
    • 2017-10-27
    240 min

    [XRW-385]My Stepmom Is A Transsexual 4 Hour Special What!？ Are You Serious!？ His Father Got Remarried To A Transsexual, So What Will His Son Think When He Sees His New Mom's Big Dick？ How Will His Daughter React？

  • yukino akari shiho canon censoredcreampiebig titsXRWreal workskoji tsujireal real worksXRW-385XRW385172xrw00385
    • 2017-10-27
    79 min

    [NATR-571]Incest [Silence] Your Father Is In The Next Room Aki Sasaki

  • aki sasaki censoredmomsingle workNATRnadeshikoupdatingNATR-571NATR571h-067natr00571
    • 2017-10-26
    46 min

    FC2PPV 690111 [Personal shooting] God milk Loli daughter complete fall NTR “This is the first time ♥” Inexperienced area demon Pis SEX that can not return to boyfriend’s dick! Young pussy bubbling with serious cloudy pussy hold continu

  • amateur uncensoredfc2
    • 2017-10-25
    241 min

    [SGSR-197]Is A Vacation The Best Opportunity!？ Picking Up Girls And Finding Married Woman Babes At A Famous Hot Springs Resort 12 Ladies/4 Hours 2

  • censoredmarried womanSGSRbig mocalprosperitynew battle groupSGSR-197SGSR19757sgsr00197
    • 2017-10-25
    80 min

    FC2PPV 689730 Life’s first shooting, first 3P ☆ ○○ A meeting to teach the splendor of 3P to a young lady who goes to a big school w A fair and beautiful slender body ♪ The second half is almost an appearance! 【selfie】

  • amateur uncensoredfc2
    • 2017-10-24
    121 min

    [DAYD-004]My Shut-In Little Sister Is Secretly A Big Tits G Cup Slut! I Became A Shut-In Too, And Now This Brother And Sister Are Having Themselves Some Private Afternoon Time! Tsubasa Hinagiku

  • hinakiku tsubasa censoredbig titsbeautiful girlDAYDadolescent fictionday dreamDAYD-004DAYD004h-839dayd00004
    • 2017-10-24
    42 min

    FC2PPV 688622 [Pregnancy sure] S-class beauty vaginal cum shot * Unauthorized Sperm comes in ♥ Rubber is removed and quasi-virgin pussy is unexpected raw SEX! Pleasure screaming when semen is poured into the womb for the first time ☆ Completely falle

  • amateur uncensoredfc2
    • 2017-10-23
    78 min

    [PRBYB-048]My Mama Is A Singing And Dancing Sexy Costume Non-Nude Erotica Idol Marina Shiraishi

  • rena shiraishi censoredbig titssingle workPRBYBintec incPRBYB-048PRBYB048h-706prbyb00048
    • 2017-10-22
    120 min

    [HOMA-026]My Wife's Sister Is Blatantly Luring Me To Temptation Ann Minami

  • minami an censoredcreampieslutHOMAh m p doramaakabane kikujirouHOMA-026HOMA026homa00026
    • 2017-10-21
    120 min

    [MIFD-018]This Amateur Lady Who Works At An Advertising Agency Is Unable To Hide The Fact That She's A Perverted Maso Bitch, And She Sent Us A Masturbation Video And Begged Us To Make Her Dreams Cum True, So She's Now Making Her AV Debut!! Ma

  • yuuri censoredbig titsMIFDmoodyztake dmoodyz freshMIFD-018MIFD018mifd00018
    • 2017-10-21
    208 min

    [BBAN-151]An Anal Volunteer Maso Barely Legal In Hardcore Lesbian Love Is Getting Her Ass Spread Wide In Lesbian Series Anal Action Karin Maizono Mao Hamasaki

  • maizono kari hamazaki mao censoredlesbianbdsmBBANvivianBBAN-151BBAN151bban00151
    • 2017-10-20
    129 min

    [HAR-082]My Sadistic Ex-Girlfriend Is My New Girlfriend's Best Friend!？ My Ex-Girlfriend Is Possessed With Jealousy And Now She's Assaulting Me While My Girlfriend Sleeps With Domination Sex And Explosive Man-Squirting!!

  • arisa kawasaki saori ishikura censoredbig titsHARprestigehardestHAR-082HAR082118har00082
    • 2017-10-20
    131 min

    [HAR-083]This Big Tits Woman Ripped Her Jeans And Now Her Ass Is Bulging Out And Ready For Some Raw Cum Shots! You'll Want To Fuck This Godly Ass Over And Over Again, Because Once Is Never Enough, And You'll Definitely Want To Keep Your Dick

  • mahiro ikegami erika censoredcreampieHARprestigeupdatingHAR-083HAR083118har00083
    • 2017-10-19
    182 min

    [IENE-829]Her First Ever Married Woman Sex Club Interview This Horny Young Wife Is Keeping A Secret From Her Husband And Having A Tense Battle With Her Instructor Who Is Not Allowed To Ejaculate In This Wet And Wild Training Session!

  • censoredcreampieIENEie nergykiku rinIENE-829IENE8291iene00829
    • 2017-10-19
    162 min

    [NHDTB-049]An NTR Molester My Wife (Age 26) Is In A Molester AV "If I Had Only Known At The Time..." My Wife Was Basted With Aphrodisiacs And Had Creampie Sex While She Was There Next To Me

  • censoredcreampieNHDTBnatural hightanaka baconNHDTB-049NHDTB0491nhdtb00049
    • 2017-10-17
    107 min

    [EHM-008]My Bride Is Mana Sakura

  • mana sakura censoredbig titssingle workEHMjuicy honeyEHM-008EHM008h-295ehm00008
    • 2017-10-16
    138 min

    [MXGS-1000]A Fresh Face Rino Sasanami This Gymnastics Star Is Making Her Shaved Pussy Limber-Bodied AV Debut!

  • sasanami censoredsingle workMXGSmaxingdera 3MXGS-1000MXGS1000h-068mxgs01000
    • 2017-10-16
    113 min

    [MXGS-998]No Matter How Tied Up She Is, This S&M Beautiful Girl Will Offer You Her Pussy For Raw Fucking Creampies Minami Hoshimiya

  • minami hoshimiya censoredcreampiebig titsMXGSmaxingdera 3MXGS-998MXGS998h-068mxgs00998
    • 2017-10-16
    68 min

    [HEYZO-1589]Maki Houjyo Freshman at the Welcom Party Is a Naughty MILF

  • maki houjyo uncensoredcreampieheyzo
    • 2017-10-15
    40 min

    FC2PPV 681663 [First shot x appearance] S-class beauty lifted I’m going again ♥ The signboard girl of a famous cafe in Tokyo is rubbed in the womb and completely falls down continuously! Back menu of rich love juice dripping from thin-haired pus

  • amateur uncensoredfc2
    • 2017-10-15
    120 min

    [TIKC-014][A Sure Thing] This Cute Tanned Gal Is A Bitch But When We Fed Her Friends Some Aphrodisiacs They Became Incredibly Unbelievable Divine Maso Bitches Who Would Let Us Fuck Them Without Any Rubbers

  • censoredcreampiebeautiful girlTIKCtikitiki.comerTIKC-014TIKC014tikc00014
    • 2017-10-14
    120 min

    [TRUM-002]A True Story Re-Enactment NTR Drama A Wedding Day Cuckold Drama I'm About To Get Married, And By Coincidence, The Manager In The Black Suit At The Wedding Chapel Happened To Be My Ex-Boyfriend Miku Hayama

  • nana yuzuki miyama hayama censoredcreampiebig titsTRUMmilf is hardkitorune kawaguchitrough maxTRUM-002TRUM002trum00002
    • 2017-10-14
    349 min

    [TURA-319]School Terrorism Committed By A Student I Slipped Some Date Rape Drugs Into The Tea At My High School Faculty Room And Fucked All The Teachers, And Now I'm Posting The Video From That Fun Time

  • censoredcreampiemature womanTURAmilf is hardTURA-319TURA319tura00319
    • 2017-10-14
    120 min

    [JUY-273]A Horny Father-In-Law Is Fucking With His Daughter-In-Law Father, Please Forgive Me... Izumi Nanase

  • censoredmarried womancosplayJUYmadonnaviva gonzoJUY-273JUY273juy00273
    • 2017-10-14
    119 min

    [VICD-364]A Lady Director Ayaka Ide Is Getting Naked And Filming Hidden Camera Lesbian Scenes! And Selling The Footage As An AV Without Permission! Vol.9 Amateur Anal Lesbian Edition

  • censoredamateurlesbianVICDviayaka datevVICD-364VICD364vicd00364
    • 2017-10-14
    115 min

    [JUY-274]This Is My Identity In The Afternoon Reika Hashimoto Exclusive Video #3 Her First Drama!! <<Filth>> The Beautiful Face Of A Housewife In The Afternoon!!

  • reika hashimoto censoredmarried womanmature womanJUYmadonnaascension shiroJUY-274JUY274juy00274
    • 2017-10-14
    159 min

    [JUY-282]Investigation!! Is It Possible To Seduce Married Woman Babes At Flea Markets？ Here's A Married Woman We Met Through A Flea Market App Ann Kurihara, Age 27 Her AV Debut!!

  • kurihara a censoredmarried womanmature womanJUYmadonnamamezawa mametaroJUY-282JUY282juy00282
    • 2017-10-14
    120 min

    [JUY-283]My Son's Colossal Tits Private Tutor Is Luring Us To Temptation With Her Hot And Horny Body Hana Haruna

  • haruna hana censoredbig titsmarried womanJUYmadonnaviva gonzoJUY-283JUY283juy00283
    • 2017-10-14
    119 min

    [SSNI-029]This J Cup Titty Office Lady Is Getting Fondled And Fucked On The Molestation Bus RION

  • rion censoredbig titssingle workSSNIs1 no 1 styleoosaki hirokoujiSSNI-029SSNI029ssni00029
    • 2017-10-13
    80 min

    [NATR-569]This Bride Is A Creampie Pheromone Housewife Yuri Nikaido

  • yuri nikaido censoredbig titsmarried womanNATRpinknadeshikoNATR-569NATR569h-067natr00569
    • 2017-10-13
    88 min

    FC2PPV 680004 [First shot] 18-year-old SS class neat girl ☆ Everything is the first experience “Ochinpo feels good ♥” The moment of awakening of a super rare undeveloped pussy that I remembered the pleasure of SEX for the first time since g

  • amateur uncensoredfc2
    • 2017-10-13
    120 min

    [SUPA-243]This Slutty Beautiful Girl Is A Member Of The Environmental Cleanup Club And In Charge Of Garbage Pickup, And She Is So Dedicated To Ecological Causes That She Has Creampie Raw Footage Sex Without Using Condoms

  • censoredcreampieamateurSUPAs kyuu shiroutojoni shibuyaSUPA-243SUPA243h-244supa00243
    • 2017-10-11
    58 min

    FC2PPV 678292 [Complete appearance 3P] S-class beauty at the celebrity level with magical medicine is a continuous vaginal cum shot Ikitai ♥ It’s been a year since I was hungry for SEX

  • amateur uncensoredfc2
    • 2017-10-10
    75 min

    FC2PPV 677922 First shot ☆ Too beautiful public ● Creampie for members! Screaming from insertion though it is graceful ♪

  • amateur uncensoredfc2
    • 2017-10-08
    150 min

    [DVAJ-278]Unstoppable Climax! Aki Sasaki Is Totally Satisfied! Reverse Soap Heaven

  • aki sasaki censoredDVAJalice japanflagmanDVAJ-278DVAJ278dvaj00278
    • 2017-10-08
    133 min

    [DOJU-090]"Why Are You Teasing An Old Lady Like Me？" This Hot Housewife Is Beautiful But Horny So We Took Her Home And Got Her Hooked On Infidelity Sex And Filmed Peeping Videos Of Her vol. 1

  • censoredcreampiemature womanDOJUjukujo japanDOJU-090DOJU090doju00090
    • 2017-10-07
    150 min

    [NNPJ-255]This Real Life College Girl At A Famous Women's University With Alluring And Slim Beautiful Legs Is Spreading Her Pussy Lips Wide Open In Rude And Crude Piston Cowgirl Action Miyuki (Age 20) In Her AV Debut!! 60 Days Together, Up Close

  • censoredamateurNNPJnampa japanNNPJ-255NNPJ255nnpj00255
    • 2017-10-07
    150 min

    [KAWD-848]A Fantastic Discovery! This Divinely Cute Beautiful Girl In A Cafe Waitress Uniform Is A Real Life Underground Idol! We Kept Going To The Cafe And Met With Her In Secret Behind Her Manager's Back And After Getting Her Number We Succeede

  • censoredamateurblowjobKAWDkawaiiupdatingKAWD-848KAWD848kawd00848
    • 2017-10-07
    116 min

    [OBA-359]This Horny Mother Is In An Illicit Relationship With Her Son's Private Tutor Yoko Shirayama

  • yoko hakusan censoredmature womanslutOBAmadonnakogatake samuraiOBA-359OBA359oba00359
    • 2017-10-06
    41 min

    FC2PPV 674261 Super popular SS class amateur E-chan 2nd work completed ★ 2nd work is training! Following the previous work, this work is also on sale for a limited time. Part 2

  • amateur uncensoredfc2
    • 2017-10-06
    120 min

    [YSN-467]I'm A Cherry Boy Who Is Obsessed With Cleanliness, And My Big Sister Looks Down On Me And My Smelly Cock, So One Day I Played Some Pranks On Her By Making Her Sniff My Cum I Thought She Would Get Mad, But It Flipped Her Eros Company Swit

  • nami sekine kimiiro kanon censoredblowjobslutYSNnonYSN-467YSN467h-127ysn00467
    • 2017-10-06
    105 min

    [YAL-077]My Son Has A Deep Sexual Hangup, He Will Only Fuck Me When My Husband Is Nearby Kiriko Nio

  • kiriko niio censoredcreampiedeepthroatYALnonYAL-077YAL077h-127yal00077
    • 2017-10-06
    120 min

    [PDD-003]Public BDSM Breaking In Yuri Asada Natsuki Yokoyama

  • asada yuri naoko yokoyama censoredPDDdream ticketthere is alsoPDD-003PDD00324pdd00003
    • 2017-10-06
    71 min

    FC2PPV 674639 Former famous actress appeared in Destron ☆ Beautiful breasts slender beauty on pure white skin! The last is a vaginal cum shot to a beautiful man ♪

  • amateur uncensoredfc2
    • 2017-10-06
    60 min

    FC2PPV 674686 Former famous actress appeared in Destron ☆ Beautiful breasts slender beauty on pure white skin! The last is a vaginal cum shot to a beautiful man ♪ [Personal shooting]

  • amateur uncensoredfc2
    • 2017-10-06
    39 min

    FC2PPV 674239 Super popular SS class amateur E-chan 2nd work completed ★ 2nd work is training! Following the previous work, this work is also on sale for a limited time. Part 1

  • amateur uncensoredfc2
    • 2017-10-05
    171 min

    [NHDTB-044]This Big Tits Massage Therapist Is Getting Cowgirl Pumped With Aphrodisiac-Laced Cocks! Watch Her Slick And Slippery Body Jiggle And Wiggle... Do You Want To Watch Her Ass？ Or Her Tits？

  • censoredbig titsNHDTBnatural highwen viewNHDTB-044NHDTB0441nhdtb00044
    • 2017-10-05
    144 min

    [SW-513]This Naughty Married Woman Is Showing These Hard Working Male Student Boys Some Erotica At The Bookstore 4 She's Rubbing Up Her Boobs Against Them In This Tiny Store And Getting Their Young Dicks Rock Hard She's Teaching Their Inexper

  • censoredbig titsSWswitchyamashiro takeshiSW-513SW5131sw00513
    • 2017-10-05
    128 min

    [MIST-177]I Am An Office Lady, And I Was Turned Into The Office Cum Bucket. This Is My Story. Every Day Was Filled With Sexual Harassment Riko Kitagawa

  • riko kitagawa censoredbig titssingle workMISTmr michirusaitaMIST-177MIST1771mist00177



    • JavHD Full is The best Jav censored and uncensored watch online free forever