first blowjob




FC2MVSDAMBIVEMACESDBLKPREDCAWDWAAAMIDESPRDFSDSSSDABPPPDDASDADNJUFECJODROYDLULUKSBJ

2023-11-21
62 min

112123_941 Pick Up A Wife Going Around Town! When I Suddenly Brought My Cock Close To My Face...

  • keiko oshita uncensoredcreampiesquirting
    • 2023-11-20
    205 min

    762FAII-002 First Facial! Amateur Girl"s Blowjob Bukkake Video! 2

  • amateur censoredamateurbukkakefaiifaii-002faii002762faii-002
    • 2023-11-20
    124 min

    NACR-728 Ten Anzai, A Lewd Girlfriend Who Begs For A Cleaning Blowjob That Makes His Penis Swell Over And Over Again.

  • anzai tenshi censoredcreampieslutNACRplanet plushimrockshichidomeNACR-728NACR728h-237nacr00728
    • 2023-11-20
    59 min

    fc2-ppv 4047376 [No] Facial Cumshot Twice! That Beautiful Face That Looks Like That Of A Celebrity Is An Old Man"s Spirit* That Makes You Fall In Love With It! Luxury Double Feature Of Facial Cumshot From Blowjob And Facial Cumshot From Raw Sex O

  • amateur uncensored
    • 2023-11-20
    98 min

    SUKE-180 [Gen Z"s Super Erotic Beautiful Big Butt] Introducing A Fresh-faced JD Who Loves Muscle Training And Is Highly Conscious! ! A Lewd Girl Who Replenishes Protein By Drinking Sperm Rather Than Protein Ww Gives A Tornado Blowjob And Ejaculat

  • amateur censoredcreampieamateursukesuke-180suke180suke-180
    • 2023-11-20
    184 min

    762FKED-009 A Secret Meeting With A Dirty Boy. Three Frustrated Married Women. Matching App Affair 3 Big Tits, Big Ass, NTR, Lewd, Plump, Young Wife, Mature Woman, Blowjob, Squirting

  • amateur censoredbig titsmarried womanfkedfked-009fked009762fked-009
    • 2023-11-20
    64 min

    fc2-ppv 4048406 Limited Quantity! Half! ! [No] [First Shot] [Face Shown] Sweaty And Serious Orgasm! Simple And Pure Peach Butt Pink Girl ~ Small Mongolian Spot On The Butt ~ FC2-PPV-4048406

  • amateur uncensoredamateurblowjob
    • 2023-11-19
    52 min

    fc2-ppv 4043766 [Monashi] Dedicated To All 48,204 Followers [Fashion Model] I Can"t Say Much More, But Raw Creampie On The Best Class Slender E Cup Body (51 Minutes) FC2-PPV-4043766

  • amateur uncensoredcreampieamateur
    • 2023-11-18
    61 min

    111823_001 PtoM Sex Kotono Murakami

  • amateur uncensoredcreampieblowjob
    • 2023-11-18
    60 min

    111823_01 Amateur Without Make-up ~Slim Girl With Small Breasts And Cute Ahegao Face

  • misa tsuzuki uncensoredamateurblowjob
    • 2023-11-18
    61 min

    111823_940 Paco Paco With A Frustrated Married Woman Who Sent Me A DM! Kaori Hisayama

  • kaori hisayama uncensoredcreampiesquirting
    • 2023-11-17
    94 min

    ERHV-028 Sexually Uninhibited Returnee Girl, Sexy Private Sex Video Of Overseas Training Leaked. Big Nipples And Muscular Slender Erotic Body Bend Over And Cum! !

  • censoredcreampieblowjobERHVhmn workslove girlfriendERHV-028ERHV028h-1472erhv00028
    • 2023-11-17
    110 min

    MVSD-572 Please Let Me Have A Drink Soon. Nana Kisaki Lovingly Swallows The Thick Semen That Has Accumulated In Her Plump Balls, Giving A Sweet And Sad Cum-swallowing Blowjob.

  • kisaki nana censoredbeautiful girlslutMVSDm s video groupthere is alsoMVSD-572MVSD572mvsd00572
    • 2023-11-17

    fc2-ppv 4015448 First Shoot! Limited To 3 Days! ! A Bulging G-cup Busty Woman Isolated From Her Surroundings! Titty Fuck With A Blowjob That Is Not Used To Being Lonely! Furthermore, 2 Consecutive Vaginal Cum Shots! !

  • amateur uncensored
    • 2023-11-17
    57 min

    fc2-ppv 4031431 490pt For A Limited Time Only! [No] I Wanted To Show Off My Girl-girlfriend ♡ I Needed To Fully Train A Modern-day Gal Who Recently Became My Sex Friend, So I Asked Her To Appear On The Show. Plenty Of Creampie After Enjoying Various

  • amateur uncensoredcreampieamateur
    • 2023-11-17
    240 min

    PBD-454 I Want To Hold More Dick In My Mouth During Sex... BEST Orgy Blowjob While Having Sex With A Beautiful Older Sister

  • aika yamagishi karen kaede censoredPBDpremiumpremium bestPBD-454PBD454pbd00454
    • 2023-11-17
    52 min

    fc2-ppv 4038170 [Uncensored] [3P] It"s Her First 3P Even Though She"s A Gal ☆ She Didn"t Reflect On The Last Time And Came Again Without Makeup, So She Called A Friend And Punished Her Hole With A Double Cock. "Don"t Insult Adults

  • amateur uncensoredcreampieamateur
    • 2023-11-17
    180 min

    MIDV-531 "If It"s Just A Blowjob, It"s Not Cheating, Right？" Seducing A Married Teacher With A Blowjob And Licking Her 20 Times NTR Mia Nanasawa

  • nanasawa mia censoredschoolgirlsingle workMIDVmoody sbungo maedamoodyz divaMIDV-531MIDV531midv00531
    • 2023-11-17
    66 min

    fc2-ppv 4036482 [Individual Shooting 94] Fully Exposed 20-year-old With A Huge Shaved Pussy ** In The First Shoot, She Is Exposed Outdoors And Raped 11 Times In A Row, Then Creampied, Then Re-injected, Then A Cleaning Blowjob, And The Second Time Is

  • amateur uncensoredcreampieamateur
    • 2023-11-17
    120 min

    PRED-531 I"m Sorry For Making You Ejaculate With A Beautiful Older Sister"s Intense Blowjob Ai Takashima

  • takashima ai censoredsingle workPREDpremiumcomet akaielegancePRED-531PRED531pred00531
    • 2023-11-17
    55 min

    fc2-ppv 4025291 [S Class Beauty] Intense Sex Video With A Slutty Beauty Who Looks Like A Tall 173cm E Cup Girl! Contains Two Creampies In Total, Once On The Sofa And Once On The Bed *Bonus High Resolution FC2-PPV-4025291

  • amateur uncensoredcreampieblowjob
    • 2023-11-17
    53 min

    fc2-ppv 4038576 [Uncensored] Sexual Desire Demon, Kourin. Stab Her Stylish Whitening Body**! Participating In The Halloween Event, The Paripi Women Are Intertwined With Each Other Violently And Deeply, Making Them Fall Into Pleasure! FC2-PPV-4038576

  • amateur uncensoredblowjob
    • 2023-11-16
    56 min

    111623_01 Amateur AV Interview ~Fashionable Sex With Perfect Joints~

  • mizuki shindo uncensoredcreampieamateur
    • 2023-11-16
    20 min

    111623_001 Chinguri Return Anal Play Without Blowjob Ryoka Shinoda

  • suzuka shinoda uncensoredblowjobslut
    • 2023-11-16
    61 min

    111623_939 A Mature Woman With A Gross Pussy Is Fucked Thoroughly

  • amateur uncensoredcreampieamateur
    • 2023-11-16
    49 min

    fc2-ppv 4031210 ★Half Price Until 11/26★ [Uncensored/Complete Amateur] A Naive Amateur With Small Breasts Who Looks Like She Just Came Out Of The Countryside! She Throws Away Her Shyness And Moans As She Enjoys The Wet Raw Sex Of A Middle-aged Man Sh

  • amateur uncensoredamateurblowjob
    • 2023-11-15
    95 min

    YARIA-038 I"ll Take Your Slut"s Ass! Maria Chan (26)

  • censoredcreampieblowjobYARIAyariman bitchesYARIA-038YARIA0381yaria00038
    • 2023-11-15
    60 min

    INSTV-503 [Real Pregnancy Shooting] Yui (31) Let"s Have A Third Child♪ 100 Pregnancy Insemination SEX Video Of A Couple Who Makes Breast Milk And Big Breasts Wife Creampie Leaked

  • censoredcreampiebig titsINSTVhmn worksinstaINSTV-503INSTV503h-1472instv00503
    • 2023-11-15
    18 min

    fc2-ppv 4029645 I Paid A Lot Of Money For A Big-time O-chan With Divine Breasts And A Great Figure To Have A Sex Video Www FC2-PPV-4029645

  • amateur uncensoreduniformamateur
    • 2023-11-15
    53 min

    fc2-ppv 4030206 [Uncensored] Slender Lounge Lady In Roppongi. Immediately Removes The Uncle"s Cock With A Sticky Handjob Blowjob! Unable To Resist The Man In His Rolls Royce, His Pride Collapses And His Cock Falls! ! FC2-PPV-4030206

  • amateur uncensoredcreampieslut
    • 2023-11-15
    110 min

    YARIA-037 I"ll Take Your Slut"s Ass! Mizuki Chan (25)

  • censoredcreampieblowjobYARIAyariman bitchesYARIA-037YARIA0371yaria00037
    • 2023-11-14
    83 min

    fc2-ppv 4027553 [Today Only] Not .●.years Old/whitening Slender F Cup! Super Cute With The Highest Rank! Innocent And Extremely Well-liked ♪ She Impregnates Her Vagina With More Than 2 Times The Old Man"s Semen And Cums Twice In A Row! Even More

  • amateur uncensoredcreampieamateur
    • 2023-11-14
    129 min

    fc2-ppv 4025293 A 19-year-old Fair-skinned F-cup Girl Who Has Just Become A JD, Rin-chan Looks Like A Korean Idol. Just When You Thought She Was Pure And Innocent... 120 Points For Blowjob And Cowgirl! At The End, ``I Have A Boyfriend, But Please Cum

  • amateur uncensoredamateur
    • 2023-11-13
    68 min

    fc2-ppv 4022334 [Nothing/Beauty/Fuck] Shaved Genital Torture In A Honey Pot. Squirting Repeatedly With Endless Orgasms. 2 Holes Inserted With Anal Vibrator. She Falls In Pleasure With Two Merciless Large Amounts Of Creampie. FC2-PPV-4022334

  • amateur uncensoredanalcreampie
    • 2023-11-13
    59 min

    fc2-ppv 4022651 [No] A Super Lewd Medical Worker Can"t Forget Having Sex With An Old Man... First, He Swallows His Favorite Rich Sperm With A Blowjob, And Then Has Sex With Creampie From Behind! In The End, We Have Lovey-dovey Sex On The Bed *Bon

  • amateur uncensoredcreampieblowjob
    • 2023-11-10
    156 min

    fc2-ppv 4012693 [First Shot ♡] 0343_001 Luna-chan, 20 Years Old, 170 Cm Tall Older Sister With Outstanding Style, JD, Shows Her Face Completely, Irresponsibly Impregnates The World, And Ends Her Life With Her AV Debut With Raw Creampie (explosion) FC

  • amateur uncensoredcreampieblowjob
    • 2023-11-10
    72 min

    fc2-ppv 4012088 [No/Child/Fuck] Climax Of Pleasure With Shameful Genital Torture. It"s My First Time To Reach An Endless Climax. She Opened Her Eyes Wide And Mercilessly Ejaculated Twice. FC2-PPV-4012088

  • amateur uncensoredcreampieamateur
    • 2023-11-07
    56 min

    fc2-ppv 4000224 Limited Quantity! Half! ! [No] Proud Cali Torture Cowgirl Position. Compare The Taste Of Sucking Pussy And Anus. The Uncle Is Very Satisfied With The Cleaning Blowjob At The End FC2-PPV-4000224

  • amateur uncensoredanalcreampie
    • 2023-10-12
    67 min

    DORI-100 Paco Shooting No.100 Nina-chan, A Beautiful Girl With Small Breasts Who Feels So Good That She Allows Creampie, Nina Fukunaga

  • it s in tomikunaga censoredcreampieschoolgirlDORIfirst starpaco shootingDORI-100DORI100h-491dori00100
    • 2023-10-07
    240 min

    YLWN-282 “I Never Thought I Would Hold My Daughter’s Husband’s Cock In My Mouth” Is Forbidden! Wife"s Mother Blowjob Video 4 Hours

  • censoredblowjobmature womanYLWNyellow moonpatpong tateishiYLWN-282YLWN282ylwn00282
    • 2021-11-29
    50 min

    fc2-ppv 2467799 [Uncensored] [4K Quality] [Facial Appearance] A Genuine Idol. An 18-year-old Active Student, Short 147cm Tall Beautiful Girl Honoka, Plays In Uniform, Gives A Blowjob, And Gets Revenge By Impregnating A Large Amount Of Creampie With A

  • amateur uncensoredcreampieamateur
    • 2023-11-14
    269 min

    SDAM-079 A Female College Student From An Athletic Club Found At Lake Yamanaka. Would You Like To Enter The Men"s Bath With Just A Towel？ 57 Overcome The Embarrassment With The Concentration And Physicality Of Her Hot, Tight, Naive Body, She Desp

  • censoredamateurblowjobSDAMsod createsaijo akira chain sectsod amateurSDAM-079SDAM0791sdam00079
    • 2023-11-14
    50 min

    111423_938 Soap Technique For Your Husband!

  • amateur uncensoredcreampieblowjob
    • 2023-11-14
    149 min

    STARS-957 Licking Sex With Each Other, Hibiki Natsume, Licking Every Drop Of Ejaculated Sperm With The Best Blowjob

  • natsume hibiki censoredbig titsblowjobSTARSsod createcrestsod starSTARS-957STARS9571stars00957
    • 2023-11-12
    99 min

    567BEAF-093 Almost 100 Chance Of Success! ! A Very Popular Bitch On A Certain Dating Site. Instant Blowjob, Instant Cunnilingus, Super Plump, Around 40"s. Legendary Instant Sex Slut. Yukari, 38 Years Old.

  • amateur censoredcreampiebig titsbeafbeaf-093beaf093567beaf-093
    • 2023-11-12
    57 min

    fc2-ppv 4018320 [90 OFF] *Until 11/19 * [Facial Exposure] [No] This Is The First Experience Of Gonzo For An 18-year-old Amateur, And He Ejaculates Twice In The Mouth And Vagina Without Any Questions Asked. FC2-PPV-4018320

  • amateur uncensoredcreampieamateur
    • 2023-11-11
    117 min

    BONU-033 A Day Of Amazing Blowjob And Face Sitting For An Aunty Deli Girl Miki Yamase

  • miki yamase censoredcreampiesingle workBONUtroubled group delusion grouprusher miyoshiblow jobBONU-033BONU033bonu00033
    • 2023-11-11
    61 min

    111123_001 Glamorous Runa Yamagishi

  • runa yamagishi uncensoredcreampieblowjob
    • 2023-11-11
    60 min

    111123_01 It Feels So Good I Can"t Do It Anymore! Amateur Girl"s Pussy Goes Over The Limit With Raw Dick For The First Time In A While!

  • yui mitsukawa uncensoredcreampieamateur
    • 2023-11-11
    86 min

    MAAN-921 [Series Classic Fastball Bitch! An Erotic Butt Lady Appears In All Directions! ] Interview With A Super Carnivorous Beauty Who Eats Everyone, And Her Reward Is Money And Cock! ？ Gorgeous Slender Curvaceous BODY! The Best Blowjob And Butt Job

  • amateur censoredcreampiesquirtingmaanmaan-921maan921maan-921
    • 2023-11-11
    240 min

    YLWN-286 Genuine Amateur Working Lady"s Raw Saliva Handjob Blowjob 4 Hours

  • censoredamateurYLWNyellow moonpatpong tateishiYLWN-286YLWN286ylwn00286
    • 2023-11-11
    66 min

    111123_937 The Anus Of A Mature Woman With An Erotic Mole Around Her Mouth...

  • noriko takeda uncensoredcreampieamateur
    • 2023-11-10
    54 min

    fc2-ppv 4011671 490pt For A Limited Time Only! [No] Creampie Sex On A Sleepover Date With Mayu-chan, Who Came To Tokyo From The Countryside ♡ I Made Her Wear A “boyfriend Shirt” And Her Pussy Became Muddy With A Thick Dildo ♡ I Love My Uncle’s Dick S

  • amateur uncensoredcreampieamateur
    • 2023-11-10
    150 min

    IPZZ-136 An Age-man Who Will Instantly Make You Erect.If You Call Him, He Will Immediately Lick You.He Will Give You An Unparalleled Blowjob At Rufriend. 9 Consecutive Cum In The Mouth! ! Airi Kijima

  • airi kijima censoredsingle workIPZZidea pocketzampatissueIPZZ-136IPZZ136ipzz00136
    • 2023-11-10
    70 min

    529STCV-385 A Hyper Gal With Plump Black Skin And A Beautiful Butt Returns In Search Of A Cock! ! Even Though She Says It"s Been A While Since She"s Had Sex, She Explodes With Her Battle-hardened Blowjob Technique → Squeezes Cum In Her Mouth!

  • amateur censoredcreampiesquirtingstcvstcv-385stcv385529stcv-385
    • 2023-11-10
    83 min

    546ERHV-027 Frustrated, A Super Cute Gal With An Old Man Fetish. She Gives A Blowjob With A Sticky Tongue Technique, And Her Beautiful Big Breasts And Beautiful Butt Come Close To You In The Cowgirl Position. She Pretends To Be Greedy And Has Crazy C

  • amateur censoredcreampiebig titserhverhv-027erhv027546erhv-027
    • 2023-11-10
    120 min

    JUQ-436 Maki Hojo, My Female Boss Who Caught Me Going To A Pin Salon During My Break And Gave Me A Blowjob Repeatedly

  • hojo asahi censoredsingle workJUQmadonnaorion chairJUQ-436JUQ436juq00436
    • 2023-11-10
    64 min

    fc2-ppv 4000161 [No] Gonzo With A Gal Who Looks Like Koshiba 〇 Hana ♡ A Lot Of Facial Cum Shot Of The Semen* That I Had Saved Up For Several Days On A Lewd Girlfriend With A Strong Sexual Desire! After That, Creampie SEX On The Bed ♡ *Bonus High Qual

  • amateur uncensoredcreampieblowjob
    • 2023-11-10
    53 min

    fc2-ppv 4012695 [Uncensored/Reverse 3P] *** Seduces A Big Cock And Has A 3P Fuck. Minimal And Supreme Reverse 3P Harem Where You Make Out In Front Of Your Friends. A Neat Girl Looking At Her Friend Whose Pussy Is Being Penetrated By A Demon Piston. F

  • amateur uncensoredcreampieblowjob
    • 2023-11-10
    160 min

    HUNTB-696 Slow Piston In A Girls" Dormitory Where Boys Are Prohibited! Silent SEX! My Roommate Is Sleeping Right Next To Me! I Suppressed My Voice As We Had Sex, But It Seemed Like He Found Out, So Later...

  • censoredcreampieblowjobHUNTBhuntermorikihhh groupHUNTB-696HUNTB696huntb00696



    • JavHD Full is The best Jav censored and uncensored watch online free forever