single work




FC2ATIDBLKSDABNACRAVSAHNDFSDSSDASDDTTNNPJJULRBDSPRDAWDSHKDMEYDCESDCAWDPPPDWANZ

2023-09-29
150 min

MIDV-500 Shrimp Warping Gyuin! 497 Climaxes, 7913 Convulsions, 55305cc Climax Special, Abstinence Orgasm Orgasm, Teased For 1 Month, 24 Hours A Day, Big Dick FUCK, Shiki Hakuto

  • four seasons in hakuto censoredbeautiful girlsingle workMIDVmoody scomet akaimoodyz divaMIDV-500MIDV500midv00500
    • 2023-09-29
    188 min

    MIDV-484 Newcomer, An Unfinished Stone Who Doesn"t Know How To Become Cute Yet, Makes Her AV Debut Yui Mihama

  • mitsuhama yui censoredbeautiful girlsingle workMIDVmoody susapyonmoodyz divaMIDV-484MIDV484midv00484
    • 2023-09-29
    120 min

    SAME-078 This Is The Story Of My Cousin Aki, Who Grew Up Beautiful And Confined To My Dirty Room, Where She Became A Shut-in And A NEET. Moko Sakura

  • sakura moko censoredsingle workdramaSAMEattackerstakuo otanideath night evilSAME-078SAME078same00078
    • 2023-09-29
    120 min

    CAWD-588 Pure White G Cup, Aiho Suzu Kawaii* Exclusive Decision! Breasts Shaking Violently And Creampie Release Special

  • aiho tin censoredcreampiebeautiful girlCAWDkawaiisugawaraCAWD-588CAWD588cawd00588
    • 2023-09-29
    120 min

    RBK-083 Pushed Back By A Modest Curiosity... Confessions Of A Lady"s Wife Who Is Swamped By The Influence Of Others. Hikaru, A Young Wife Who Betrayed Her Husband And Became Addicted To Sex. Catalog Of Follies Hikaru Miyanishi

  • miyanishi hikaru censoredsingle workdramaRBKattackersinugami ryodragonRBK-083RBK083rbk00083
    • 2023-09-29
    120 min

    ATID-574 "Old Man, I"m Home." Emma, ​​who Took Her Virginity, Has Returned For The First Time In 10 Years. Futaba Emma

  • futaba emma censoredcreampieschoolgirlATIDattackersdragon nishikawain madATID-574ATID574atid00574
    • 2023-09-29
    120 min

    MIDV-434 I Was Driven Crazy By A Group Of Molesters On The Train On My Way To Work... Nana Yagi Steals The Movements Of A Frightened, Silent Office Lady And Plays With Her Sensitive Genitals.

  • nana yagi censoredsingle workMIDVmoody skitorune kawaguchimoodyz divaMIDV-434MIDV434midv00434
    • 2023-09-29
    150 min

    WAAA-302 I Missed The Last Train After Drinking At Work And Stayed The Night At My Female Boss"s House, But It Was Discovered That I Ejaculated Prematurely, And I Was Made To Ejaculate Hard From Friday Night Until Monday Morning.Kana Morisawa

  • kana morisawa kanako iioka censoredcreampieslutWAAAones factorywanzWAAA-302WAAA302waaa00302
    • 2023-09-29
    95 min

    VENX-236 Reiko Kobayakawa, A Big-breasted Creampie Son Sucked By His Mother-in-law"s Busty Breasts

  • kobayakawa reiko censoredcreampiesingle workVENXvenuspetaincestVENX-236VENX236venx00236
    • 2023-09-29
    140 min

    WAAA-304 Iron Hook Tearing Pussies And Incontinence Torture BAR Manager Goes Crazy And Leaks Cum Inside A Prison Of Shame! ! AIKA

  • aika censoredcreampiesquirtingWAAAones factorywanzWAAA-304WAAA304waaa00304
    • 2023-09-29
    120 min

    BF-695 When I Returned To My Hometown For The First Time In A While, My Childhood Friend, Who Was Once A Flat-faced Girl, Had Grown To Big Breasts And Seduced Me. She Creampied Into Her Defenseless Body Many Times...Konatsu Kashiwagi

  • kashiwagi konatsu censoredschoolgirlbeautiful girlBFbefreeBF-695BF695bf00695
    • 2023-09-29
    120 min

    WAAA-303 I Asked My Plump Wife At My Part-time Job To Be My Tutor... Ai Sayama

  • sayama love censoredcreampiesingle workWAAAones factorywanzWAAA-303WAAA303waaa00303
    • 2023-09-29
    130 min

    FOCS-154 I Turned My Boss"s Plain-looking Daughter Into A Meat Urinal And Addicted To Dick With An Aphrodisiac Sex... Madoka Kuga

  • kuga madoka censoredcreampiebeautiful girlFOCSabc delusion groupfocusFOCS-154FOCS154focs00154
    • 2023-09-29
    150 min

    MIDV-496 Sweaty Serious Paco! Lewd Exposed Hot Spring Trip Embarrassed, Wet And In Love With Cock Yoru Tsukigumo

  • yoru tsukumo censoredsingle workMIDVmoody stake dmoodyz divaMIDV-496MIDV496midv00496
    • 2023-09-29
    160 min

    MIAA-966 Ultra-luxury Creampie Specialty Soap Sora Amakawa

  • tenkawa sora censoredcreampielingerieMIAAmoody szach araieveryone s kikatanMIAA-966MIAA966miaa00966
    • 2023-09-29
    150 min

    SAME-077 A Beautiful Girl Whose Father Will Never Let Her Have Sex Is Imprisoned In A Love Hotel And Raped All Day Long. Konatsu Kashiwagi

  • kashiwagi konatsu censoredschoolgirlsingle workSAMEattackersdeath night evilSAME-077SAME077same00077
    • 2023-09-29
    120 min

    SAME-075 If You Want A Recommendation, Suck My Dick. Sexual Harassment, Power Harassment, Etc. A Student Who Fell Into The Sexual Processing Tool Of A Selfish Teacher. Minami Maeda

  • maeda minami censoredcreampieschoolgirlSAMEattackerskitorune kawaguchideath night evilSAME-075SAME075same00075
    • 2023-09-29
    120 min

    MIAA-979 As A Result Of Feminist Women Complaining That The Small Surface Area Of  

  • hinako mori censoredcreampiecosplayMIAAmoody sdragon nishikawaeveryone s kikatanMIAA-979MIAA979miaa00979
    • 2023-09-29
    120 min

    MIDV-492 Big Tits Wife With Big Nipples, Crotch Orgasm Riho Shishido In A Worn-out Bachelor"s Dormitory

  • shishido riho censoredsingle workMIDVmoody smichiru arashiyamamoodyz divaMIDV-492MIDV492midv00492
    • 2023-09-29
    120 min

    ATID-573 Apparently My Wife Was Trained A Long Time Ago. Airi Kijima

  • airi kijima censoredsingle workATIDattackerskitorune kawaguchiin madATID-573ATID573atid00573
    • 2023-09-29
    240 min

    JFB-323 3rd Anniversary Of Resurrection - Lots Of Ejaculation In Cute Mouth And Natural Icup - Reina Momozono Fellatio & Titty Fuck 4 Hours BEST

  • reina taoyuan censoredbeautiful girlsingle workJFBfitchJFB-323JFB323jfb00323
    • 2023-09-29
    120 min

    MIAA-978 Pheromone Brother"s Wife Is Turned Into A Reverse Bunny Housekeeper, And A Runaway Dick Turns Into A Meat Urinal And Immediately Cums In Her Pussy 14 Times Kaho Tamaki

  • tamaki natsuho censoredcreampiecosplayMIAAmoody scaptain gangwoneveryone s kikatanMIAA-978MIAA978miaa00978
    • 2023-09-29
    150 min

    MIAA-922 I Encountered A Former Young Senior Who Was Bullying Me At A Delivery Health Service For A Masochist Woman...The Positions Were Reversed And I Was Forced To Restrain Her And Force Her To Pee! Yuuki Hiiragi Was Made Into A Creampie Meat Urina

  • hiiragi yuuki censoredsquirtingsingle workMIAAmoody scomet akaieveryone s kikatanMIAA-922MIAA922miaa00922
    • 2023-09-29
    120 min

    WAAA-309 "Eh! You Just Let It Out Inside Me, Right？" After The Sudden Ejaculation, The Extension Piston Is Used To Catch Up And Cum Inside Without Pulling It Out! ! Mai Arisu

  • arisu mai censoredcreampieschoolgirlWAAAones factorywanzWAAA-309WAAA309waaa00309
    • 2023-09-29
    210 min

    WAAA-300 If You Can Endure Rima Arai"s Amazing Technique, You Can Have Raw ★ Creampie Sex!

  • lima arai censoredcreampiebeautiful girlWAAAones factorywanzWAAA-300WAAA300waaa00300
    • 2023-09-29
    160 min

    JUFE-511 The I-cup Wife Of A Former AV Actress Who Moved To The Countryside Has A Naughty Daily Life Where She Plays With Men Who Flock To Her Breasts Monami Takarada

  • takarada monami censoredcreampiesingle workJUFEfitchbebop minoru 2 0JUFE-511JUFE511jufe00511
    • 2023-09-29
    120 min

    CAWD-595 Ichika, My Childhood Friend From Next Door Who Came To Borrow A Bath Because The Water Heater Was Broken, Couldn"t Stand The Sweaty Skin, The Smell Of Shampoo, And The Glimpse Of Her Small Breasts, So She Stole Away From Her Parents And

  • ichika matsumoto censoredcreampiesingle workCAWDkawaiitake dCAWD-595CAWD595cawd00595
    • 2023-09-29
    120 min

    YUJ-010 "I"m Getting Married, Right？" That"s Right...Then I Won"t Let You Sleep Tonight...The Night Before My Wedding, I Creampied With My Ex-girlfriend For The First Time In 12 Years Until The Sun Rose. Tsubaki Sannomiya

  • sannomiya tsubaki censoredcreampieslutYUJattackersthere is alsokidding girlYUJ-010YUJ010yuj00010
    • 2023-09-29
    130 min

    CAWD-566 Sleep Rape Creampie Rape: Female Student Trained To Climax While Sleeping Natsu Hinata

  • natsu hinata censoredcreampieschoolgirlCAWDkawaiiasagiriCAWD-566CAWD566cawd00566
    • 2023-09-29
    120 min

    ADN-494 Please Forgive Me... An Unfaithful Wife"s Sense Of Immorality Kaho Tamaki

  • tamaki natsuho censoredsingle workdramaADNattackersnagira kenzoadult dramaADN-494ADN494adn00494
    • 2023-09-29
    138 min

    DVRT-026 "I Dedicate My Daughter..." Impregnation Training, Insemination SEX In Front Of Her Parents Ena Koume

  • ena koume censoredcreampieschoolgirlDVRTdeepstokyo boydeep s 2nd storeDVRT-026DVRT026dvrt00026
    • 2023-09-29
    160 min

    CAWD-576 Super Cute Cosplay X Cute Temptation! Totally Subjective Masturbation Support That Will Make Your Brain Melt 8 Changes Sumire Kuramoto

  • sumire kuramoto censoredcreampiesingle workCAWDkawaiihide monkCAWD-576CAWD576cawd00576
    • 2023-09-29
    120 min

    MIAA-980 A Slutty Rider With Huge Breasts Who Comes Riding A Motorcycle To Rape A Masochistic Man.

  • otsu alice censoreduniformslutMIAAmoody sthere is alsoeveryone s kikatanMIAA-980MIAA980miaa00980
    • 2023-09-29
    120 min

    MIAA-984 Ambushing A Female Manager J-type From The Baseball Club Who Was Popular And Rumored At Other Schools And Giving Her 1000 Knock-on Rapes And 41 Creampies In A Row Mai Arisu

  • arisu mai censoredcreampiesingle workMIAAmoody scameleveryone s kikatanMIAA-984MIAA984miaa00984
    • 2023-09-29
    184 min

    FOCS-155 Real Virgin Debut, First Tense Uncut Sex For The First Time, Minami Kazama

  • kazama minami censoredbeautiful girlsingle workFOCSabc delusion groupfocusFOCS-155FOCS155focs00155
    • 2023-09-29
    120 min

    MIDV-489 Women"s Basketball Club Training Camp - Once You Have Sex, It"s Over! After Losing To The Sexual Harassment Reinforcement Training Of A Senior Who Hates Her Beautiful Legs, She Is Shot Deep Inside Her Vagina And Punished With 100 Pis

  • guba censoredbeautiful girlsingle workMIDVmoody smamezawa mametaromoodyz divaMIDV-489MIDV489midv00489
    • 2023-09-29
    120 min

    MIDV-491 5 Days Of Tsundere Living With A Cheeky Childhood Friend Hinano Kuno

  • kuno hinano s censoredbeautiful girlsingle workMIDVmoody skyouseimoodyz divaMIDV-491MIDV491midv00491
    • 2023-09-29
    120 min

    ADN-499 My Rationality Went Crazy When I Saw The Transparent T-back Of My Married Woman Boss. Miu Shiramine

  • shiramine miu censoredsingle workADNattackershiroyuki kimuraadult dramaADN-499ADN499adn00499
    • 2023-09-29
    120 min

    CAWD-586 A 13 Year Old Figure Skater With No Experience In Sex Orgy, A Genius Girl Is Tortured With 19 Big Cocks And Creampied For The First Time Shion Chibana

  • chibana shion censoredcreampiebeautiful girlCAWDkawaiimichiru arashiyamaCAWD-586CAWD586cawd00586
    • 2023-09-29
    150 min

    JUFE-514 A Sexy Adult Woman Licks My Ear And Whispers Vulgar Dirty Words With Her Sweet Breath Kanna Misaki

  • kanna misaki censoredcreampieslutJUFEfitchyumeno aidaJUFE-514JUFE514jufe00514
    • 2023-09-29
    160 min

    SAME-079 Circle Plan President"s Secretary Edition Yuna Hasegawa

  • hasegawa yuna censoredsingle workSAMEattackersdeath night evilSAME-079SAME079same00079
    • 2023-09-29
    130 min

    MIAA-977 My Girlfriend"s Younger Sister Licks, Sucks, And Gives Me A Blow Job While She"s Away, So I Haven"t Been Able To Stay Away From Her For Seven Years. Sumire Kuramoto

  • sumire kuramoto censoreduniformbeautiful girlMIAAmoody sxxleveryone s kikatanMIAA-977MIAA977miaa00977
    • 2023-09-29
    120 min

    CAWD-580 A Secret After School That You Can"t Tell Your Friends About. Momo Shiraishi Has Dangerous Obscene Sex With A Perverted Old Man Who Is Filled With Greed In A Dark Sex Room.

  • momo shiraishi censoreduniformbeautiful girlCAWDkawaiik westCAWD-580CAWD580cawd00580
    • 2023-09-29
    120 min

    MIDV-488 The Slender Female Manager Is A Pet Who Can Insert As Much As She Wants In Her Vagina And Instantly Relieves Her Sexual Desire, Mio Ishikawa.

  • ishikawa mio censoredbeautiful girlsingle workMIDVmoody strendy yamaguchimoodyz divaMIDV-488MIDV488midv00488
    • 2023-09-29
    154 min

    DVEH-015 Yuina Taki, A Tall And Beautiful Personal Trainer With A Voluptuous Big Butt Who Repeats The Temptation To Collapse Her Rationality In Search Of The Best Protein (sperm)

  • taki yuina censoredcreampiesingle workDVEHdeepspearl father jrdeep s 3rd storeDVEH-015DVEH015dveh00015
    • 2023-09-29
    150 min

    JUFE-518 First Climax! AV Erotic Development That Makes The White Whipped Beautiful Body Crazy Shiori Minami

  • minami shiori censoredsquirtingsingle workJUFEfitchtrendy yamaguchipreciousJUFE-518JUFE518jufe00518
    • 2023-09-29
    120 min

    MIAA-958 A Caring G-cup Tits Private Tutor Who Thoroughly Manages Grades. Private Tutoring With Raw Creampie To Improve Grades. Yuri Morishita

  • morishita yuri censoredcreampieslutMIAAmoody scaptain gangwoneveryone s kikatanMIAA-958MIAA958miaa00958
    • 2023-09-29
    130 min

    JUFE-520 Only When My Girlfriend Comes Home...A Childhood Friend Azuma Amazuki Rubs Her Big Butt Without Wearing Panties And Squeezes Out My Sperm.

  • amatsuki azu censoredsingle workJUFEfitchkoenji goropreciousJUFE-520JUFE520jufe00520
    • 2023-09-29
    120 min

    ADN-496 Natsume Ayaharu, A Married Woman Who Fell In Love With Fertility Esthetics

  • natsume saiharu censoredsingle workADNattackersdragon nishikawaadult dramaADN-496ADN496adn00496
    • 2023-09-29
    120 min

    JBD-292 President"s Secretary - Aged Masochism Released - Nozomi Ikuta

  • ikuta nozomi censoredsingle workJBDattackerssakurafubukisnakeJBD-292JBD292jbd00292
    • 2023-09-29
    120 min

    WAAA-308 The Plump J-type Athlete"s Big Ass Is Irresistible... He Rubs His Dick Against Her Stuffy Bloomers As She Performs Squats To Strengthen Her Lower Body! Unable To Resist Each Other, They Thrust Up And Cum In Sweaty Piston Cowgirl Position

  • shirahama minami censoredcreampiesingle workWAAAones factorywanzWAAA-308WAAA308waaa00308
    • 2023-09-29
    120 min

    WAAA-307 I"m Usually A Plain And Taciturn Country Boy, But...I"m Moody And Liberated! Talented AV Debut With Full Body Erogenous Zones Yuuriha

  • yuzu leaves censoreduniformsingle workWAAAones factorywanzWAAA-307WAAA307waaa00307
    • 2023-09-29
    120 min

    ADN-495 Raped In Front Of My Husband - Shameful Video Letter Emi Nishino

  • nishino emi censoredsingle workdramaADNattackerssatoshi morikawaadult dramaADN-495ADN495adn00495
    • 2023-09-28
    121 min

    FGAN-094 T-back Anal Temptation. The Woman Is Seduced By The Wrinkles Of Her Anus Peeking Through Her Racy T-back, And She Is Thrust Back And Forth Continuously! Ayumi Natsukawa

  • natsukawa ayumi censoredsingle workFGANfetish eyesFGAN-094FGAN094h-1440fgan00094
    • 2023-09-28
    121 min

    FGAN-093 Three Sacred Treasures Of High School Girls: Little Devil Beautiful Girl Masturbation Support Mai Arisu

  • arisu mai censoredschoolgirlsingle workFGANfetish eyesFGAN-093FGAN093h-1440fgan00093
    • 2023-09-28
    121 min

    AARM-197 A Rejuvenating Beauty Treatment Performed By A Super Beautiful Transsexual Who Knows Everything About A Man"s Erogenous Zones. Chibitori

  • chibitori censoredsingle workAARMaroma planningshigeo kakuwakiaromaAARM-197AARM197aarm00197
    • 2023-09-28
    131 min

    YOCH-004 A Beautiful Witch Who Is Difficult To Approach...but In Reality She Is Very Cheerful And Really Perverted! She Is Covered In Drool And Goes Crazy With Her Longed-for Unrivaled Cock! Hazuki Morishita

  • morishita hazuki censoredsingle workYOCHcenter villageyoichi sanotaoyuanYOCH-004YOCH004h-086yoch00004
    • 2023-09-27
    129 min

    TENN-012 Outdoor Exposure Training Ring Pleasure Orgasm Heaven Akari Minase

  • minase akari censoredcreampiesingle workTENNfirst starfirst star first starTENN-012TENN012h-491tenn00012
    • 2023-09-27
    121 min

    NEBO-009 Disqualified As A Guardian Uncle, I"d Be Lonely If You Weren"t Here. Madoka Kuga

  • kuga madoka censoredcreampieuniformNEBOfirst starnebokeNEBO-009NEBO009h-491nebo00009
    • 2023-09-27
    119 min

    FNEO-077 Female Brat 07 Little Boy Rimu-chan 154cmH Cup The Secret Erotic Play Exploration Of A Minimum Beautiful Girl Who Loves Old Men. Rimu Yumino

  • yumino rimu censoredcreampiebeautiful girlFNEOfirst starfirst star neoFNEO-077FNEO077h-491fneo00077



    • JavHD Full is The best Jav censored and uncensored watch online free forever